KEGG   Methanothermococcus okinawensis: Metok_1244Help
Entry
Metok_1244        CDS       T01534                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
mok  Methanothermococcus okinawensis
Brite
Enzymes [BR:mok01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Metok_1244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1271787..1273301
Genome map
AA seq 504 aa AA seqDB search
MLFLKVKYLDLDLETNAIIINEEDLKGTAYYPHDRVLVETSGGSFIGTLYSTKTMVSPGE
VGFSKTIMPMPLKEGEEVRIRHAQKPSSLNYIKKKMEGQTLKPHEIHTIVDEIVSKKLSN
IELTAFVVSNYINGMETNEIVEMTKRMADTGEKLEWENSPIVDVHSIGGVPGNKYALLTI
PIVASAGIIIPKTSSRAITSAAGTADIVEVLANVNLNAEEIKRVVKATNGCLVWGGAVNL
APADDIIINVERPLAIDPKPQLLASVMAKKIATGINYTVIDIPIGPGVKIKNEKEGNQLA
RKFIELGDLLGIRVECVLTYGGQPIGRAIGPALEAREALMALTDFKSAPNSLIEKSTSLA
GVLLELGGAAQPGKGNKLAWEILSSGKALEKFNEIITEQGGKETKPDEIEVGNFSADIIS
PDNGYITYISNKLITNVAKEAGAPKDKKAGILLHAKVGDKVDKGEVLYTIYSSSEERLNA
AVNLARRTYPVKVEGMLLKRISKF
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttttaaaggttaaatatttagatttggatttagaaactaatgcaattattata
aatgaggaagacttaaaaggaactgcatattaccctcatgatagggttttagtggaaacc
tcaggaggttcttttataggaacattatactcaacaaaaacgatggtatctccgggagaa
gtgggttttagtaagactatcatgcctatgcctttgaaagaaggggaagaggttagaata
agacacgctcaaaaaccttcatctttaaattatattaagaaaaaaatggaaggtcagact
ttaaaacctcatgagatacatacgatagtggatgaaattgtatctaaaaagttatcaaac
attgaattaactgcatttgtagtttccaactatataaatggtatggaaacaaatgaaatt
gtcgaaatgacgaagagaatggctgatacaggagaaaaacttgaatgggagaatagccct
attgtggatgttcatagtattgggggtgttcctggaaataaatatgcactcctcaccatc
ccaatagtggcatctgccggtataatcattccaaaaacctcatcaagagccattacctca
gcagctgggacagctgatattgtagaagtccttgcaaatgtaaatttaaatgcagaagag
ataaaaagagtggtaaaagctacaaacggatgtttagtttggggaggagctgttaatctt
gcaccagcagatgatatcataataaatgtggagagaccacttgcaatagaccctaaacct
caattgcttgcaagtgttatggcaaagaagattgcaacaggtataaactacaccgtaatt
gatatccccattggacctggtgtaaagataaaaaatgaaaaagagggaaaccaattagca
aggaaatttatagagctcggggacttacttggaattcgtgttgaatgtgttttgacatac
ggtggtcagccaataggtagggcaataggtcctgcacttgaagcgagggaagctttaatg
gcattaacagatttcaaatcagctccaaacagtttaattgaaaaatccacttcgcttgca
ggggtgttattagaacttggaggagcagcacagcccggaaaaggtaataaattggcatgg
gaaattttatcatcaggaaaagcattggagaaatttaatgagataataactgaacagggt
ggaaaagaaacaaaacccgatgaaattgaagtgggaaatttcagtgcagatataatttct
cctgataatggatatataacatatatatcaaataagttaattacaaatgtggcaaaagag
gcaggagctccgaaggataaaaaggcaggaattctattgcatgcaaaagtaggggataag
gtggataaaggggaagtattatataccatttattcgagctcggaagagaggctaaatgcc
gcagttaatcttgcaagaagaacctatcctgtgaaagtcgaaggcatgctccttaaaaga
attagcaaattttaa

DBGET integrated database retrieval system