KEGG   Methanothermococcus okinawensis: Metok_1283Help
Entry
Metok_1283        CDS       T01534                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
mok  Methanothermococcus okinawensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mok01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mok01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mok00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1312420..1314351
Genome map
AA seq 643 aa AA seqDB search
MNILINASNKKYETINKEFFPINWGIYLHKKYETWKYDVYDEHNIFCFGRGVIPIIGGHR
LIFSFRSPLWDGFHFSAMGGAGYVFKNTGLHNVAIIGKCEKPSLLILDGEGEDLKVEFME
LNESNGFDIKNYKNIYDLNEYILKKFNEKNYRAFIVGPASLNTNMGGIFSQTVRNGKLVE
GSEDWAARGGVGSVLCRAHNILGVVYYGKNGTDEEVKKQKDIEKRLRNIVEEHYKKPYMT
VVLEHTKKYRYNEKTKTGGTFGNNYHYTLDITPIFNWRMPYIHKNDRIELHKKIMKYFVE
TFNKESIEPKKWTNCGEPCPVLCKKYRNGLKVDYEPYESNGPLLGIFDIHAADKIVHTVD
ALGFDAIEFGNLASYVFELLHVGLLKPEEVGIDKPIFDITHYQTDDDILKNSQYNAELAV
KLANIIAFKKNELAKILSLGKRKASKILNDKFKDRLMTKNADKFNYEKFEDFGVYIPFGD
NGEISPTQYWAIGNFMPYLIQGKYLTYYQCGEFLEPEELAKLSVERVIMEITIEDLGICR
FHRKWIYPIIKPLLKEITDVDLDSTIKELIKDICEYDKKIGYPPYIESQRVKDLIMAGAG
EFGNDKWALEFNSKGEVKLKEYIKRVMNEYSRLLNIDWKIKED
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttaataaatgcttccaataaaaaatatgaaactataaataaagaatttttt
cccataaattggggaatatacctccataagaaatatgaaacctggaaatatgatgtttat
gatgaacataatatattctgctttggaagaggggttataccaataattggaggtcatagg
cttatattttctttcaggtctccactttgggatggattccatttctcagcaatgggaggt
gcaggatatgtatttaaaaacacaggattacataatgttgcaataattggaaaatgtgaa
aaaccaagtttattgatattggatggtgaaggagaagatttaaaagtagaatttatggaa
cttaacgaaagtaatggatttgatataaaaaattataaaaatatatatgatttgaatgaa
tatattctaaaaaaattcaatgaaaagaattatagggcatttattgtaggtcctgcatcg
ttaaatacaaatatggggggaatattctctcaaactgtaagaaacggaaagttagttgaa
ggctctgaggattgggctgcacggggtggtgtaggttctgtattatgccgagctcataac
atattaggggtggtatattatggtaaaaatggaacggatgaagaggtaaaaaaacagaag
gatattgaaaaaagactgaggaatattgtagaagaacactataaaaaaccgtatatgact
gttgttcttgaacatactaaaaaatacagatataatgaaaaaacaaaaacagggggaact
tttggaaataattaccattatacacttgatattacccctatatttaactggagaatgccc
tatattcataaaaatgatagaatagaacttcataaaaaaataatgaagtattttgtagaa
acatttaataaagaatccatagaacctaaaaaatggactaattgtggagaaccatgccct
gtattgtgcaaaaaatatagaaatggcttaaaagtggattatgaaccttatgagtccaat
ggtccattacttggtatatttgatatacatgccgcagataaaatcgtgcatactgtggat
gcccttggttttgatgccatagaatttggaaatttggcatcctatgtatttgaactactt
catgtggggcttttaaaaccagaggaagttgggatagataaacccatatttgatataaca
cactaccaaaccgacgatgatattttaaaaaattcgcaatataatgcagagctcgcagtg
aaacttgcaaatataatagcatttaaaaagaatgaactggctaaaatactatcacttgga
aaaagaaaggcatcaaaaatacttaacgataaatttaaagataggttaatgactaaaaat
gctgataaattcaattatgagaaattcgaagattttggtgtatatattccttttggtgat
aatggagagatatccccaactcaatattgggctattggaaattttatgccttatttaatt
caagggaaatatttaacatattatcaatgtggggaattcttagaaccagaagaattggca
aaacttagtgttgaaagagttataatggaaataacaatagaagatttaggtatttgcaga
ttccacagaaaatggatttatccaataattaaaccacttttaaaggaaataaccgatgta
gatttagatagcacaattaaagaattaattaaggatatctgtgaatacgataaaaaaata
ggatatccaccctacatagaaagtcaaagagttaaagatttgataatggctggtgcaggg
gagtttggaaatgataagtgggcattggaatttaacagtaagggggaagtcaaactaaaa
gaatacataaaaagagttatgaacgaatacagtagattactaaatattgattggaaaata
aaggaagattaa

DBGET integrated database retrieval system