KEGG   Methanothermococcus okinawensis: Metok_1433Help
Entry
Metok_1433        CDS       T01534                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00860  Porphyrin and chlorophyll metabolism
mok01100  Metabolic pathways
mok01110  Biosynthesis of secondary metabolites
mok01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mok00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metok_1433
Enzymes [BR:mok01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Metok_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 BRAP2
Motif
Other DBs
NCBI-ProteinID: AEH07398
UniProt: F8AK32
Position
complement(1477733..1478503)
Genome map
AA seq 256 aa AA seqDB search
MKVVITRPPEQGIEFANLLKENTNNNSNRNSNNDFEPILIPTLKLVFKDVSVDLDKYDWV
VFTSPRGVLGLFNNLDKSDINKIKNKKIGVIGIKTAKEFKRIFGRDVDVMPNEYTADYLL
KVLKEHINKDEKILIPTTPSARDILHKNLNADIIYVYSSEEPNNLKDKLKELKDIIIEEE
KNNKKIILTFTSGLTAKNFFKNSDDELFNLLKNHYIVSIGPITNRIVEHYGFKGYIPNEY
TVEGMIEVIKSLKNRH
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagtaattacaaggccaccagagcagggaattgaatttgccaatctgttaaag
gaaaatactaataataatagtaatagaaatagcaataacgattttgaaccaatattaatt
ccaacattgaaattggtatttaaagatgtcagtgtagatttagataaatacgattgggtg
gtatttacaagccctaggggggttttaggattgtttaataatttggataaatcagatata
aataagataaaaaacaaaaaaataggagtaattgggataaaaactgcaaaggaatttaag
aggatatttgggagggatgtagatgtaatgcctaatgaatatacagcagactatctttta
aaggttttgaaagaacatattaataaagatgaaaagatattgatacctacaacaccatct
gcaagagatattttgcacaaaaatctaaatgcagatataatatatgtatattcctccgaa
gaacccaataatctaaaagataaacttaaagaattgaaggacattataattgaggaggag
aaaaataataaaaaaataatattaacctttacaagtggtttaactgcaaagaattttttt
aaaaattcagatgacgagttatttaatctactaaaaaatcattatattgtttcaataggt
ccaattacaaatagaattgttgagcactatggatttaaaggctatattccaaatgaatat
acagttgagggtatgattgaagttattaaatctctaaaaaatagacactaa

DBGET integrated database retrieval system