KEGG   Methanothermococcus okinawensis: Metok_1574Help
Entry
Metok_1574        CDS       T01534                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
mok  Methanothermococcus okinawensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1615097..1616152
Genome map
AA seq 351 aa AA seqDB search
MAVIDYLKELSTAEGISGREDNIRNIMEKELKKYCDEVYTDKLGNLIAKKGNKGPKIMFA
AHMDEIGLMVKYIDENGFLKFTKIGGINDQMLLNQKVIVHTDKGNIVGVLGSKPPHKMKE
SERNKLINYEDMFIDIGAKNREDAQKMGVEIGSWISFKSDFDELGNNRVSCKSFDNRAGC
AVLLEVAKELSEKELNCQVYFVGTVQEEVGLKGARTSAFGINPDVAFALDVTICGDHPGI
KLEDAPIELGKGPAVGIIDASGRGLIAHPKVLKMVKEVSNKYNISVQYEVGEGGTTDATA
IYLTREGIPTGVISVPSRYIHTPVEVIDTKDLNETVKLVSSCIKELPNYFQ
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaattgattatttaaaagaattatccacagcagaaggtatttcaggaagggaa
gataatataagaaatataatggaaaaagaacttaaaaaatactgtgatgaagtatatacc
gataaacttggaaacttaatagcaaaaaaaggaaataaaggacctaaaataatgtttgca
gcacatatggatgaaattggattaatggttaaatatattgatgaaaacggattcttaaaa
tttacaaaaataggtggaataaacgaccagatgcttttgaatcagaaggtaattgtccat
acagataaaggaaatatagtaggcgttttaggttcaaaaccaccacataaaatgaaagag
agtgaaagaaacaaattaataaactatgaggatatgtttatagatattggggcaaaaaat
agggaagacgctcaaaaaatgggtgtagagataggttcatggatttcatttaaatcagat
tttgacgagctcggtaataatagggtttcctgtaaatcatttgataacagggcaggatgt
gccgttttattggaagttgcaaaagaattaagtgaaaaggaattaaactgtcaggtgtat
ttcgttggaactgttcaggaagaggttggattaaagggtgcaagaacatcggcttttggc
attaatccagatgtggcatttgcactcgatgtaacaatatgtggagaccatccaggtata
aaacttgaagatgctcctattgaattgggaaaaggtccagcagtaggtataatcgatgct
tcgggaagaggtttaattgctcatccaaaggttttaaaaatggtaaaagaggtatcaaat
aagtataatatatctgttcagtatgaggttggagaaggaggaacaacagacgctactgca
atatatctaacacgagaaggtattcctacgggagttatttcagttccttccagatatata
catacacctgttgaggtaattgataccaaagatttaaatgaaactgttaagttggtgagc
tcctgtattaaggaattacctaactatttccaatag

DBGET integrated database retrieval system