KEGG   Mesorhizobium opportunistum: Mesop_0055Help
Entry
Mesop_0055        CDS       T01542                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mop  Mesorhizobium opportunistum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mop03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(59744..60349)
Genome map
AA seq 201 aa AA seqDB search
MSKRIAGPEIERLIQLLAKVPGLGPRSARRAALHLIKKKEQLLSPLAAAMGEAADKVRIC
STCGNVDTSDPCMICTDPRRDATTLIVVEDVSDLWALERAAAMNVRYHVLGGTLSPLDGV
GPDQLNIRSLIDRVAGGEVKEIILAVNATVEGQTTAHYLTDQLSGFDIKVTRLAHGVPVG
GELDYLDEGTLAAALRSRTAF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacgaatcgccggtcccgagatcgaacgcctgatccaactcctggccaaggtg
ccgggtcttggcccccgttcggccaggcgtgcggctctccatctgatcaagaagaaggag
cagctcctgtcgccactcgccgccgccatgggcgaagccgccgacaaggtgcgcatctgt
tccacttgcggcaatgtcgacacctcggatccttgcatgatctgcaccgatccacgccgc
gacgccaccaccttgatcgtcgtcgaggacgtctcggatctctgggcgctggagcgggca
gcggcgatgaacgtgcgctatcatgtgctcggcggcacgctgtcgccgctcgacggcgtc
ggccccgaccagctcaacatccgctcgctgatcgaccgcgtcgccggcggcgaggtcaag
gaaatcatccttgccgtcaacgccacggtcgagggccagaccaccgcgcactacctcacc
gaccaactgtccggcttcgacatcaaggtgacgcgccttgcgcatggcgtgccggtcggc
ggcgaactcgactatctcgacgaaggcacgctggcggctgcacttaggtcgcggacggcg
ttttga

DBGET integrated database retrieval system