KEGG   Mesorhizobium opportunistum: Mesop_0065Help
Entry
Mesop_0065        CDS       T01542                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
mop  Mesorhizobium opportunistum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mesop_0065
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mesop_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
68218..68898
Genome map
AA seq 226 aa AA seqDB search
MDSNEVNKLLAGLLGTVFVVFSVGIVSDALFASPAPEKPGFAIEAAEPAEGGPAAPAAAA
KPIADLLATANVEQGAAVFKKCQACHSGEKGGPNKVGPDLWDLVDRPVAEHEGFAYSAGM
KEFSKGGTEKWTYDNINHFITSPKKFVKGTAMGFAGLPKDEDRANVIAYLRTLSDNPKPL
PAPGAAADAGAPAKPADGAAPAKPADGAAPAKPAAPAAPAPAAPAK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggattccaacgaagtcaacaagctgctcgccggattgctcggaaccgttttcgtcgtt
ttctcggtcggtattgtgtccgatgcgctgtttgcctcgccggcgccggaaaagcccggc
ttcgccatcgaggccgccgagccagccgaaggcggcccggccgcgccggccgccgcggcc
aagccgatcgccgacctgctggcgaccgccaatgtcgagcaaggcgccgccgtcttcaag
aaatgccaggcttgccattccggtgaaaagggcggccccaacaaggtcggccccgatttg
tgggacctcgtcgaccgtccggttgccgagcatgaaggctttgcctattcggccggcatg
aaggaattctccaaaggcggcaccgagaagtggacctacgacaacatcaaccacttcatc
acctcgccgaagaaattcgtgaagggcacggccatgggcttcgccggcctgcccaaggac
gaggaccgcgccaacgtgatcgcctatctgcgcacgctgtcggacaatcccaagccgctg
ccggcacctggtgccgccgccgatgccggcgcaccggccaagcccgccgatggagccgct
ccggcaaagcccgctgacggcgccgcaccggccaagccggccgctcccgcagcaccggct
cccgctgctccggccaaataa

DBGET integrated database retrieval system