KEGG   Mesorhizobium opportunistum: Mesop_0230Help
Entry
Mesop_0230        CDS       T01542                                 

Definition
Nucleotidyl transferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mop  Mesorhizobium opportunistum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mesop_0230
   00052 Galactose metabolism
    Mesop_0230
   00500 Starch and sucrose metabolism
    Mesop_0230
   00520 Amino sugar and nucleotide sugar metabolism
    Mesop_0230
Enzymes [BR:mop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mesop_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(250464..251360)
Genome map
AA seq 298 aa AA seqDB search
MKKIRKAVIPVAGLGTRFLPATKSMPKEMLPVVDRPVVQYAVDEAFEAGIEHIVFVTGRN
KAVIEDYFDLHPELIGTLEQTGKKTQLEALESMLPVAGATSFIRQQSPQGLGHAVWCARE
VIGNEPFALLLPDMVSFGRRGCLAETVDLYERTGGNVIAVERCDPSETNKYGIVGRGADI
GGGFEVSAMVEKPAPANAPSNFYINGRYILQPEIFALLGNQQRGAGNEIQLTDAMVRLSK
DQPFFAQPFLGRMFDCGSKEGFIQANIAFALARDDMKGPVFEMLQEFVQSHERQEEAA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcaggaaggccgtgataccggtggcggggcttggaacacggttcctgccg
gcgaccaagtcgatgccgaaggaaatgctgccggtggtcgacaggccggtcgtgcaatat
gcggtggacgaggccttcgaggccggcatcgagcacatcgtgttcgtgaccggccgcaac
aaggcggtcatcgaggactatttcgacctgcatccggaattgatcggaaccctggagcag
accggcaagaagacccagctggaggcgctcgaaagcatgcttcccgtggccggcgccacc
tccttcatccgccagcagtcgccgcaaggcctcggccatgccgtctggtgcgcacgcgag
gtcatcggcaacgagcccttcgccctgcttttgcccgacatggtttccttcggtcgccgc
ggatgtctcgccgaaacggtcgacctttatgaacgcaccggcggcaacgtcatcgccgtc
gagcgctgcgatccgagcgagaccaacaaatatggcatcgtcggccgcggtgccgacatc
ggcggcggtttcgaggtctcggccatggttgaaaagcctgcaccggccaatgcaccgtcg
aacttctacatcaacggccgctacatcctgcagcccgagatcttcgcgcttctgggcaat
cagcagcgcggcgccggcaacgagatccagctgacggacgccatggtccggctgtcgaag
gatcagccgttcttcgcccagcctttcctcggccgcatgttcgattgcggttccaaggaa
ggcttcatccaggccaacatcgccttcgcgctggcgcgcgacgacatgaagggtccggtc
ttcgagatgcttcaggagttcgtccagtcgcatgaacgtcaggaagaagccgcataa

DBGET integrated database retrieval system