KEGG   Mesorhizobium opportunistum: Mesop_0412Help
Entry
Mesop_0412        CDS       T01542                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mop  Mesorhizobium opportunistum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesop_0412
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesop_0412
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mesop_0412
Enzymes [BR:mop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mesop_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(453788..455038)
Genome map
AA seq 416 aa AA seqDB search
MNKPATPNSFRTGPDEQGMFGIFGGRFVAETLMPLILDLERHWNEVKDDPEFRAELTDLS
THYAGRPSKLYFAEGLTRHLREVSAAKGLGGGAKVYFKREDLNHTGSHKINNCLGQILLA
KRMGKKRIIAETGAGQHGVASATVAARFGFPCVVYMGATDVARQSPNVFRMKLLGAEVRP
VTAGHGTLKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARAQILE
QEGRLPDTIIAAVGGGSNAIGLFHPFLDDKEVRIIGIEAGGRGLDGIEHCASMNAGAPGV
LHGNRTYLLQNADGQIMDGHSISAGLDYPGVGPEHSWLRDSGRVDYVPILDDEALEAFKL
TTRVEGIIPALESAHAIAHAVKIVPAMDKDQIVIVNLSGRGDKDVHTVASMLGMEI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccggcgacacccaattccttccgcaccggacccgacgagcagggcatgttc
ggcattttcggcggtcgtttcgtcgccgaaacgttgatgccgctgatcctcgacctcgaa
cggcactggaacgaggtcaaggacgatccggagttcagggctgaactgacggatctttcg
acccactatgccggccggccctcgaaactctatttcgccgaaggcctgaccaggcatctt
cgcgaggtttccgcggcgaagggcctggggggcggcgcaaaggtctatttcaagcgcgag
gacctgaaccacaccggttcgcacaagatcaacaactgcctcggccagatcctgctcgcc
aagcgcatgggcaagaagcgcatcatcgccgagaccggcgccggccagcacggcgtggcg
tccgccaccgtcgccgcccgcttcggctttccctgcgtcgtctatatgggcgccaccgac
gtcgcccgccaaagccccaacgtctttcgcatgaagctgctcggggccgaagtgcggccg
gtgacagccggccacggcaccttgaaggacgccatgaacgaggcccttcgcgattgggtg
accaatgtcgaggatacctactacctgatcggtaccgccgccggcccgcatccctatccg
gaactggtgcgcgacttccagtcggtcatcggcacggaggcgcgcgcgcagatcctcgag
caggaaggccggttgccggataccatcatcgcggctgtcggcggcggctccaatgccatc
ggcctgttccatcccttccttgacgacaaggaggtccgcatcatcggcatagaagccggc
gggcgcggcctcgacggcatcgagcattgcgcctcgatgaacgcaggcgcgccgggcgtg
ctgcacggcaaccgcacctacctcctgcagaatgccgacggccagatcatggacggccat
tcgatctcggccggtctcgactatcccggcgtcggccccgagcactcctggctgcgcgac
tccggccgcgtcgactatgtgccgatcctcgacgacgaggcgctggaggccttcaagctg
acgacccgcgtcgaaggcattatcccagcgctggaatccgcccacgccattgcccacgcg
gtgaagatcgtgcccgccatggacaaggaccagatcgtcatcgtcaacctgtccggccga
ggcgacaaggacgtgcatacggttgcctcgatgctgggcatggagatctga

DBGET integrated database retrieval system