KEGG   Mesorhizobium opportunistum: Mesop_0412Help
Entry
Mesop_0412        CDS       T01542                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00260  Glycine, serine and threonine metabolism
mop00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mop01100  Metabolic pathways
mop01110  Biosynthesis of secondary metabolites
mop01130  Biosynthesis of antibiotics
mop01230  Biosynthesis of amino acids
Module
mop_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesop_0412
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mesop_0412
Enzymes [BR:mop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mesop_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Tom7
Motif
Other DBs
NCBI-ProteinID: AEH84907
UniProt: F7Y1S9
Position
complement(453788..455038)
Genome map
AA seq 416 aa AA seqDB search
MNKPATPNSFRTGPDEQGMFGIFGGRFVAETLMPLILDLERHWNEVKDDPEFRAELTDLS
THYAGRPSKLYFAEGLTRHLREVSAAKGLGGGAKVYFKREDLNHTGSHKINNCLGQILLA
KRMGKKRIIAETGAGQHGVASATVAARFGFPCVVYMGATDVARQSPNVFRMKLLGAEVRP
VTAGHGTLKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARAQILE
QEGRLPDTIIAAVGGGSNAIGLFHPFLDDKEVRIIGIEAGGRGLDGIEHCASMNAGAPGV
LHGNRTYLLQNADGQIMDGHSISAGLDYPGVGPEHSWLRDSGRVDYVPILDDEALEAFKL
TTRVEGIIPALESAHAIAHAVKIVPAMDKDQIVIVNLSGRGDKDVHTVASMLGMEI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccggcgacacccaattccttccgcaccggacccgacgagcagggcatgttc
ggcattttcggcggtcgtttcgtcgccgaaacgttgatgccgctgatcctcgacctcgaa
cggcactggaacgaggtcaaggacgatccggagttcagggctgaactgacggatctttcg
acccactatgccggccggccctcgaaactctatttcgccgaaggcctgaccaggcatctt
cgcgaggtttccgcggcgaagggcctggggggcggcgcaaaggtctatttcaagcgcgag
gacctgaaccacaccggttcgcacaagatcaacaactgcctcggccagatcctgctcgcc
aagcgcatgggcaagaagcgcatcatcgccgagaccggcgccggccagcacggcgtggcg
tccgccaccgtcgccgcccgcttcggctttccctgcgtcgtctatatgggcgccaccgac
gtcgcccgccaaagccccaacgtctttcgcatgaagctgctcggggccgaagtgcggccg
gtgacagccggccacggcaccttgaaggacgccatgaacgaggcccttcgcgattgggtg
accaatgtcgaggatacctactacctgatcggtaccgccgccggcccgcatccctatccg
gaactggtgcgcgacttccagtcggtcatcggcacggaggcgcgcgcgcagatcctcgag
caggaaggccggttgccggataccatcatcgcggctgtcggcggcggctccaatgccatc
ggcctgttccatcccttccttgacgacaaggaggtccgcatcatcggcatagaagccggc
gggcgcggcctcgacggcatcgagcattgcgcctcgatgaacgcaggcgcgccgggcgtg
ctgcacggcaaccgcacctacctcctgcagaatgccgacggccagatcatggacggccat
tcgatctcggccggtctcgactatcccggcgtcggccccgagcactcctggctgcgcgac
tccggccgcgtcgactatgtgccgatcctcgacgacgaggcgctggaggccttcaagctg
acgacccgcgtcgaaggcattatcccagcgctggaatccgcccacgccattgcccacgcg
gtgaagatcgtgcccgccatggacaaggaccagatcgtcatcgtcaacctgtccggccga
ggcgacaaggacgtgcatacggttgcctcgatgctgggcatggagatctga

DBGET integrated database retrieval system