KEGG   Mesorhizobium opportunistum: Mesop_0454Help
Entry
Mesop_0454        CDS       T01542                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00010  Glycolysis / Gluconeogenesis
mop00030  Pentose phosphate pathway
mop00051  Fructose and mannose metabolism
mop00052  Galactose metabolism
mop00680  Methane metabolism
mop01100  Metabolic pathways
mop01110  Biosynthesis of secondary metabolites
mop01120  Microbial metabolism in diverse environments
mop01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesop_0454
   00030 Pentose phosphate pathway
    Mesop_0454
   00051 Fructose and mannose metabolism
    Mesop_0454
   00052 Galactose metabolism
    Mesop_0454
  Energy metabolism
   00680 Methane metabolism
    Mesop_0454
Enzymes [BR:mop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mesop_0454
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Mesop_0454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEH84949
UniProt: F7Y2Y2
Position
497688..498854
Genome map
AA seq 388 aa AA seqDB search
MTGTFVIAQGGGPTAVINQTVVGATLEIRKRHPGAKVLGSIHGVRGIRDGNYVDLSAIPE
DRLRLIAGTPSAALGSTRDKPDAAYCEIILNGLKKAGADAFIYIGGNDTSGTQQILTDAA
GGSIAFVHAPKTIDNDLEENDHTPGFISAAEFVAGAFLSVDLDFRALPGIYVGIVMGRHA
GFLTAAAAAWQLDPGSGPHLVYVPERPFSAAGFIDDVRATLDRHKRCIVAVSEGVSTADG
KALVESLVPPNKLERDAHGNVKLSGSDLPAALERALAEGLPGKRARVDALGYMPRGYVGA
ISAVDAQEAFDAGAFAVSVAEQGGGSVALQYDGAKTVLKKVPLKNVAGKTRHMPDNFMQP
DVNQLSEAGMAYLKRLVPEKYKVGKPFV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaacttttgtcatcgcgcagggtggcggcccgaccgccgtcatcaaccaaacg
gtggtcggtgcgacgctggagatccgcaagcggcatccgggcgccaaggtgctgggctcc
atccacggcgtgcgcggcattcgtgatggcaactatgtcgacctctcggccattcccgaa
gaccgcctgcggctgatcgccggaacgccaagcgctgcactgggctcgacgcgcgacaag
ccggatgccgcctattgcgaaatcatcctcaacggcctgaagaaggccggcgccgacgcc
ttcatctatattggcggcaacgacacatcggggacgcagcaaatcctgaccgatgcggcc
ggcggcagcatcgctttcgtccatgcgccgaaaaccatcgacaatgacctcgaggaaaac
gaccacacgccggggttcatctcggccgccgagttcgtcgccggcgccttcctgtccgtc
gatctggatttccgcgcgctgcccggcatctatgtcggcatcgtcatgggccggcatgca
ggcttcctgaccgcggccgccgccgcctggcagctcgatcccggtagcggcccgcatctg
gtctacgtgccggaacggccattctcggccgccggcttcatcgatgacgtgcgcgccacg
ctagaccgccacaaacgctgcatcgtcgccgtgtcggaaggcgtcagcaccgccgacggc
aaggcgctggtcgaaagcctggtgccgccgaacaagctcgagcgtgacgcgcatggcaac
gtcaagctgtcgggcagcgacctgccggcggcgctcgagcgggctctggccgaaggcctg
ccgggcaagcgcgcccgggtcgatgcactcggctacatgccgcgcggctatgtcggcgcc
atcagcgccgtcgacgcgcaagaggccttcgatgccggcgccttcgccgtctccgtcgcc
gaacaaggcggcggctcggtggcgctgcagtatgacggcgctaaaacggtgctgaagaag
gtgccgctgaagaacgtcgccggcaagacccgccacatgcccgacaatttcatgcagccc
gacgtcaaccagctgtccgaggccggtatggcctacctcaagcggctggtgccggaaaag
tacaaggtcgggaagccgttcgtctga

DBGET integrated database retrieval system