KEGG   Mesorhizobium opportunistum: Mesop_0454Help
Entry
Mesop_0454        CDS       T01542                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mop  Mesorhizobium opportunistum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesop_0454
   01230 Biosynthesis of amino acids
    Mesop_0454
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesop_0454
   00030 Pentose phosphate pathway
    Mesop_0454
   00051 Fructose and mannose metabolism
    Mesop_0454
   00052 Galactose metabolism
    Mesop_0454
  Energy metabolism
   00680 Methane metabolism
    Mesop_0454
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mesop_0454
Enzymes [BR:mop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mesop_0454
Protein phosphatases and associated proteins [BR:mop01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mesop_0454
Messenger RNA biogenesis [BR:mop03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Mesop_0454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
497688..498854
Genome map
AA seq 388 aa AA seqDB search
MTGTFVIAQGGGPTAVINQTVVGATLEIRKRHPGAKVLGSIHGVRGIRDGNYVDLSAIPE
DRLRLIAGTPSAALGSTRDKPDAAYCEIILNGLKKAGADAFIYIGGNDTSGTQQILTDAA
GGSIAFVHAPKTIDNDLEENDHTPGFISAAEFVAGAFLSVDLDFRALPGIYVGIVMGRHA
GFLTAAAAAWQLDPGSGPHLVYVPERPFSAAGFIDDVRATLDRHKRCIVAVSEGVSTADG
KALVESLVPPNKLERDAHGNVKLSGSDLPAALERALAEGLPGKRARVDALGYMPRGYVGA
ISAVDAQEAFDAGAFAVSVAEQGGGSVALQYDGAKTVLKKVPLKNVAGKTRHMPDNFMQP
DVNQLSEAGMAYLKRLVPEKYKVGKPFV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaacttttgtcatcgcgcagggtggcggcccgaccgccgtcatcaaccaaacg
gtggtcggtgcgacgctggagatccgcaagcggcatccgggcgccaaggtgctgggctcc
atccacggcgtgcgcggcattcgtgatggcaactatgtcgacctctcggccattcccgaa
gaccgcctgcggctgatcgccggaacgccaagcgctgcactgggctcgacgcgcgacaag
ccggatgccgcctattgcgaaatcatcctcaacggcctgaagaaggccggcgccgacgcc
ttcatctatattggcggcaacgacacatcggggacgcagcaaatcctgaccgatgcggcc
ggcggcagcatcgctttcgtccatgcgccgaaaaccatcgacaatgacctcgaggaaaac
gaccacacgccggggttcatctcggccgccgagttcgtcgccggcgccttcctgtccgtc
gatctggatttccgcgcgctgcccggcatctatgtcggcatcgtcatgggccggcatgca
ggcttcctgaccgcggccgccgccgcctggcagctcgatcccggtagcggcccgcatctg
gtctacgtgccggaacggccattctcggccgccggcttcatcgatgacgtgcgcgccacg
ctagaccgccacaaacgctgcatcgtcgccgtgtcggaaggcgtcagcaccgccgacggc
aaggcgctggtcgaaagcctggtgccgccgaacaagctcgagcgtgacgcgcatggcaac
gtcaagctgtcgggcagcgacctgccggcggcgctcgagcgggctctggccgaaggcctg
ccgggcaagcgcgcccgggtcgatgcactcggctacatgccgcgcggctatgtcggcgcc
atcagcgccgtcgacgcgcaagaggccttcgatgccggcgccttcgccgtctccgtcgcc
gaacaaggcggcggctcggtggcgctgcagtatgacggcgctaaaacggtgctgaagaag
gtgccgctgaagaacgtcgccggcaagacccgccacatgcccgacaatttcatgcagccc
gacgtcaaccagctgtccgaggccggtatggcctacctcaagcggctggtgccggaaaag
tacaaggtcgggaagccgttcgtctga

DBGET integrated database retrieval system