KEGG   Mesorhizobium opportunistum: Mesop_0460Help
Entry
Mesop_0460        CDS       T01542                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00220  Arginine biosynthesis
mop00330  Arginine and proline metabolism
mop01100  Metabolic pathways
mop01110  Biosynthesis of secondary metabolites
mop01130  Biosynthesis of antibiotics
mop01230  Biosynthesis of amino acids
Module
mop_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Mesop_0460
   00330 Arginine and proline metabolism
    Mesop_0460
Enzymes [BR:mop01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Mesop_0460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEH84955
UniProt: F7Y2Y8
Position
complement(503598..504434)
Genome map
AA seq 278 aa AA seqDB search
MKLTIILASYDSGHYHGGMGQGPDALIAGGLVDALTMAGHDVTVEDIGRVGDAQEREIAT
GFAVCNAVSGEVRIAIDRGRFPIVLAGNCLTSAGAVAGEGADAIIWADQHGDLNTPETST
YGFLDGMALATVLGLCWRPMAGAIPGFKPIDPSRCVLVNARDLDPDEEKLVETLPIIRTE
CPGVAQATAKLKAAGAERVHMHLDLDVHDPEELQANRYVTPGGPDPEQLRDAACAIALAV
PVVGITVSAYDPAFDAQADVPPLVGQLLNDLIATIEGR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctcaccatcatcctggcctcctatgacagcggccattatcatggcggcatgggc
cagggccccgatgcgctgatcgcaggcggcctcgtcgacgccctgaccatggccggccac
gacgtgaccgtggaggatatcggcagggtcggcgatgcccaggaacgcgagatcgccacc
ggctttgccgtctgcaatgccgtctcaggcgaggttcgcattgccatcgacaggggccgg
ttccccattgtgctggccggaaattgcctgacatcagccggtgcggtcgcaggcgagggt
gccgatgcgatcatctgggcagaccagcatggcgatctcaacacgcccgagacatccaca
tacggctttctcgacggcatggcgctggcgacggtgctcggcctttgctggcgtccgatg
gcgggcgccattccgggcttcaagccgatcgatccctcgcgctgcgtgctcgtcaacgcg
cgcgatctcgatccggacgaggaaaaacttgtcgagacgctgccgatcatccgcacggaa
tgccccggcgtggcacaagcgacggcaaagctgaaggctgccggcgccgaacgcgtgcac
atgcatctcgatctcgacgtgcacgatcccgaggagctgcaggccaaccgctacgttacc
cccggcgggccggacccggaacaattgcgcgacgcggcttgcgccatcgcgcttgccgtg
ccggtcgtcggcatcaccgtttccgcttacgatccggccttcgacgcccaggccgacgtg
ccgccgctggtcggccagctgctcaacgatcttatcgccacgatagagggccgctga

DBGET integrated database retrieval system