KEGG   Mesorhizobium opportunistum: Mesop_0590Help
Entry
Mesop_0590        CDS       T01542                                 

Definition
Nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mop  Mesorhizobium opportunistum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Mesop_0590
Enzymes [BR:mop01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Mesop_0590
    3.5.1.-  
     Mesop_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(631801..632415)
Genome map
AA seq 204 aa AA seqDB search
MADEALVVIDLQNDFCPGGALAVAGGDEIVPLVNDMIRHADHVVLTQDWHPAGHSSFASS
HPGAQPFTMIEMPYGQQTLWPDHCIQGSLGSDFHSGLAWTKAELVIRKGFRPAIDSYSAF
FENDHATPTGLAGYLRERGIDTLTLVGLATDFCVGFSALDAVSHGFKTTVRLDACRGIDL
NGSLDAMLQRMRDAGVTLEDQLSD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaagcgcttgttgtcatcgacctgcagaacgacttttgccccggcggcgcg
ctggcggttgccggcggcgacgagatcgtgccgctggtcaacgatatgatccgccatgcc
gaccatgtcgtgctgacgcaggactggcatcccgccggtcattcgagctttgcctccagc
catccgggcgcgcagcctttcaccatgatcgagatgccctacggccagcagaccttgtgg
ccggaccattgcatccagggcagcctcggctcggattttcactccggcctcgcctggacc
aaggccgagctcgtcatccgcaaggggttccgccccgccatcgacagctactcggccttc
ttcgagaacgatcatgcgacgccgaccggcctcgccggctatctcagggaacgcggcatc
gacacgctgaccctggtcgggctggcgaccgatttctgcgtcggcttttcggcgctcgac
gctgtcagccatggcttcaagaccacggtccggctcgacgcctgccgcggcatcgatctc
aacggttcgcttgatgccatgctgcagcgtatgcgcgacgccggcgtgacgcttgaagac
cagttgtcggactga

DBGET integrated database retrieval system