KEGG   Mesorhizobium opportunistum: Mesop_0590Help
Entry
Mesop_0590        CDS       T01542                                 

Definition
Nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mop  Mesorhizobium opportunistum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mop00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(631801..632415)
Genome map
AA seq 204 aa AA seqDB search
MADEALVVIDLQNDFCPGGALAVAGGDEIVPLVNDMIRHADHVVLTQDWHPAGHSSFASS
HPGAQPFTMIEMPYGQQTLWPDHCIQGSLGSDFHSGLAWTKAELVIRKGFRPAIDSYSAF
FENDHATPTGLAGYLRERGIDTLTLVGLATDFCVGFSALDAVSHGFKTTVRLDACRGIDL
NGSLDAMLQRMRDAGVTLEDQLSD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaagcgcttgttgtcatcgacctgcagaacgacttttgccccggcggcgcg
ctggcggttgccggcggcgacgagatcgtgccgctggtcaacgatatgatccgccatgcc
gaccatgtcgtgctgacgcaggactggcatcccgccggtcattcgagctttgcctccagc
catccgggcgcgcagcctttcaccatgatcgagatgccctacggccagcagaccttgtgg
ccggaccattgcatccagggcagcctcggctcggattttcactccggcctcgcctggacc
aaggccgagctcgtcatccgcaaggggttccgccccgccatcgacagctactcggccttc
ttcgagaacgatcatgcgacgccgaccggcctcgccggctatctcagggaacgcggcatc
gacacgctgaccctggtcgggctggcgaccgatttctgcgtcggcttttcggcgctcgac
gctgtcagccatggcttcaagaccacggtccggctcgacgcctgccgcggcatcgatctc
aacggttcgcttgatgccatgctgcagcgtatgcgcgacgccggcgtgacgcttgaagac
cagttgtcggactga

DBGET integrated database retrieval system