KEGG   Mesorhizobium opportunistum: Mesop_0760Help
Entry
Mesop_0760        CDS       T01542                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mop  Mesorhizobium opportunistum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesop_0760
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mesop_0760
   00630 Glyoxylate and dicarboxylate metabolism
    Mesop_0760
Enzymes [BR:mop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mesop_0760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(811164..813335)
Genome map
AA seq 723 aa AA seqDB search
MTDRVEIAGLRIARELHDFVAGEALPGTGIEAAAFWNGFSAIVHDLAPKNRALLAKRDAM
QEKLDGWYRDNGAPIDMEAYKGFLKEIGYLVPEGPAFSVSTDKVDPEIAVVAGPQLVVPV
MNARYALNAANARWGSLYDALYGTDAIPETDGAGKGKGFNPARGAKVIAWAKDFLDESAP
LTTGKWAGVNGLSVAHGALKLGEGAGITTLADPKQFVGYRGDAANPQAVLLVRNGLHVEI
VIDRDNQIGRTDPAGIADVMLESALTTIQDCEDSVAAVDAEDKVVVYRNWLGLMKGDLAE
EITKGGKSFVRKLNPDRSYTAPVGGTLTVPGRSLMLVRNVGHLMTNPAILDRDGNEVPEG
IMDAAMTALIALHDVGPSGRRMNSRAGSMYVVKPKMHGPEEVAFAVEIFDRVEALLGMPG
NTIKMGIMDEERRTTVNLREAIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAAWISAYEAWNVDTGLECGLAGHAQIGKGMWAMPDLMAAMLAEKIAHPKAGANTAWVPS
PTAATLHATHYHKVDVHAVQAALKSRPKAKLDDILSVPVAVRPNWTPDEIQRELDNNAQG
ILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLRHKVCSQIQVRDSLQR
MAAIVDRQNVGDPLYRPMAPDFDGSIAFQAACDLVFKGTSQPNGYTEPVLHARRLELKAK
ATA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcgtcgaaatcgccggattgcggattgcccgcgagctgcatgattttgtg
gctggcgaggcgttgcccggcaccggcatcgaagcggcggctttctggaacggtttttct
gccatcgtccacgacctcgcgccgaagaaccgggcgctgctggcaaaacgcgacgccatg
caggagaagctcgacggctggtatcgcgacaacggcgcccccatcgacatggaggcctac
aagggcttcctcaaggagatcggctatctcgtgcccgaggggccggccttcagcgtgtcg
acggacaaagtcgaccccgagatcgccgtcgtcgccggtccgcagctggtcgtgccggtg
atgaatgcccgctatgcgctcaacgccgccaatgcgcgctggggctcgctctacgatgcg
ctctacggcaccgatgccatccccgagaccgacggcgccgggaagggcaagggcttcaat
cccgcgcgcggcgccaaggtcatcgcctgggccaaggactttctcgacgagtccgcgccg
ctgaccacgggaaaatgggctggcgtcaacggcctctcggtggcgcacggcgcgctgaaa
ctgggtgagggcgccggcatcaccacgctcgccgatcccaagcagttcgtcggctatcgc
ggcgacgccgccaacccgcaagccgtgctgctggtcaggaacggcctgcatgtcgagatc
gtgatcgaccgcgacaatcagatcggccgcaccgatccggctggcattgccgatgtcatg
ctggagtcggcgctgaccaccatccaggactgcgaggattcggtcgccgcggtcgatgcc
gaagacaaggtcgtggtctaccgcaactggctcggcctgatgaaaggcgatctggccgaa
gagatcaccaagggcggcaagagctttgtccgcaaactcaatccggatcgctcttacacc
gcacccgtcggcggcacgctgaccgtgcccggccgttcgctgatgctggtgcgcaacgta
ggtcacctgatgaccaacccggcgatcctggaccgcgacggcaacgaagtgccagaaggc
atcatggacgccgcgatgacggcgctgatcgcgctgcacgatgtcgggccgagcgggcgg
cggatgaattcgcgcgcgggctcgatgtatgtggtgaagcccaaaatgcacgggccggag
gaagtcgccttcgccgtcgagattttcgaccgcgtcgaagccctgctcggcatgcccggg
aataccatcaagatgggcatcatggacgaggagcggcgtaccaccgtcaacctcagggaa
gcgatccgcgctgcgaaagatcgggtggtgttcatcaacaccggtttcctcgaccgcacc
ggcgacgagatacacacctcgatggaagccggcccgatgatccgcaagggcgacatgaag
caggccgcctggatttccgcctacgaggcctggaatgtcgacaccgggctcgaatgcggt
ctggccggccacgcccagatcggcaagggcatgtgggcgatgccggacctgatggcggcg
atgctggccgagaagatcgcccatcccaaggccggcgccaacaccgcctgggtgccgtcg
ccgacggcggcgacgctgcatgccacgcattaccacaaggtcgatgtccacgcagtgcag
gcggcgctgaagagccgcccgaaggcgaagctcgacgacatcctctcggtgccggtggcc
gtgcgtccgaactggacgcccgacgagatccagcgcgagctcgacaacaacgcgcagggg
attctgggctatgtcgtgcgctggatcgaccagggcgtcggctgctccaaagtgcccgac
atcaacgatgtcggcctgatggaagaccgcgccacgctgcgcatctcctcgcagcacatc
gccaactggttgcgccacaaggtgtgctcgcaaatccaggtgcgggattcgctgcaacgc
atggcggccatcgtcgaccgccagaatgtaggcgacccgctctaccggccgatggcgccc
gatttcgacggctcgatcgccttccaggccgcctgcgacctggtgttcaagggcaccagc
caacccaacggctacaccgagccggtgctgcacgcgcggcggctagagctgaaggcaaaa
gcgacggcctga

DBGET integrated database retrieval system