KEGG   Mesorhizobium opportunistum: Mesop_0995Help
Entry
Mesop_0995        CDS       T01542                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mop  Mesorhizobium opportunistum
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Mesop_0995
Enzymes [BR:mop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Mesop_0995
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Mesop_0995
Lipid biosynthesis proteins [BR:mop01004]
 Fatty acid synthase
  Component type
   Mesop_0995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1043804..1044448)
Genome map
AA seq 214 aa AA seqDB search
MSFKRRIAAGLIVFLAICGAISSARAEPFKIVGFGDSLMAGFGLGPDEGFTDKLQAALRA
KGHDVAVANAGVSGDTTSGGLARLDWSVPDGTQLVILELGANDMLRGVAPDITRKNLDEM
LAKLKGRKIAVLLAGMRAAPNLGAEYQNAFDAIFPGLAKKYDIDLYPFFLDGVAGEPGMQ
LEDGLHPSVKGIDRMVERILPTVEKAIAAAPKAS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaaacgccgcattgccgcaggcctgatcgttttcctcgccatttgcggcgcc
atttcgtcggcgcgcgccgagcctttcaagatcgtcggcttcggtgacagcctgatggcg
ggtttcggcctcggacccgacgaggggtttaccgacaaattgcaggcagcacttcgtgcc
aagggccatgatgtggctgtcgccaatgccggcgtttcgggcgacaccaccagcggcggc
ctggcgcggctcgactggtcggtgcccgacggcacgcaactggtcatcctcgaacttggc
gccaacgacatgctgcgcggcgtcgcgcccgacatcaccaggaagaacctcgacgagatg
ctggccaagctgaaagggcgcaagatcgccgtgctgctggccggcatgcgcgccgcgccc
aatctcggcgccgagtatcagaatgccttcgacgccattttcccgggcctggcgaagaaa
tacgacatcgacctttatccattcttcctcgacggcgtcgccggagagcccggcatgcag
ctcgaggatggcttgcatccgagcgtcaaaggcatcgaccggatggtcgagcgcatcctg
ccgacggtcgagaaggccatcgcggctgccccgaaagcttcgtga

DBGET integrated database retrieval system