KEGG   Mesorhizobium opportunistum: Mesop_1026Help
Entry
Mesop_1026        CDS       T01542                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mop  Mesorhizobium opportunistum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesop_1026
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesop_1026
   00640 Propanoate metabolism
    Mesop_1026
   00660 C5-Branched dibasic acid metabolism
    Mesop_1026
Enzymes [BR:mop01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mesop_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1073280..1074473
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQGKALLKSFGAPVAEGVPVFKADEAEAAAQALPGPLYVVKSQIHAGGRGKGKFK
ELGPDAKGGVRLAKSVADVVANANEMLGHTLVTKQTGPAGKQVNRLYIEDGADIERELYL
SILVDRSVGRVAFVVSTEGGMDIEAVAHDTPEKIITVAIDPEKGVTAADLKALNTALKLD
GDAANDGNTLFPILYKAFVEKDMSLLEVNPLIVMKNGRLRVLDAKVSFDNNALFRHPDVM
ELRDTTEEDEKEIEASKYDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITKDPAVKGILINIFGGIMKCDIIAEGVIAAVKEVGLKVPLVVRLE
GTNAELGKKIINDSGLNVVSADDLDDAAKKIVSAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccatgaatatcagggcaaggcgctgctgaagagctttggcgcgccggtggcc
gagggggtgccggtgttcaaggccgatgaggcggaagccgcggcacaagcgcttcccggc
ccgctctatgtggtgaagagccagattcacgccggcggccgcggcaagggaaagttcaag
gaacttggccccgatgccaagggcggcgtgcgtttggcgaagtcggtggccgatgtcgtc
gccaacgccaacgagatgctcggccacacgctggtcaccaagcagaccgggcctgccggc
aagcaggtcaaccgcctctacatcgaggacggcgccgacatcgagcgcgagctgtacttg
tcgatcctggtcgaccgttcggtcggccgcgttgccttcgtcgtctcgaccgagggcggc
atggacatcgaggcggtcgcgcatgatacgccggaaaagatcatcaccgtcgccatcgat
ccggaaaagggtgtgaccgcggccgatctgaaggcgctcaacacggcgctcaagcttgac
ggcgacgctgccaacgatggcaacacgctgttcccgatcctctacaaggcgttcgtcgag
aaggatatgagcctgctcgaggtcaacccgctgatcgtcatgaagaacggccggctgcgc
gtgctcgacgccaaggtgtcgttcgacaacaacgcgctgttccgccaccccgacgtgatg
gaactgcgcgacaccaccgaagaggacgagaaggaaatcgaggcgtccaaatacgacctc
gcctatgtcgcgctcgacggcaatatcggctgcatggtcaacggcgcgggccttgccatg
gcaacgatggacatcatcaagctctacggcgccgagcccgccaacttcctcgatgtcggc
ggcggcgcgtccaaggagaaggtgacggcggcgttcaagatcatcaccaaggatccggcg
gtcaaaggcatcctgatcaacatcttcggcggcatcatgaagtgcgacatcatcgccgag
ggcgtcatcgccgcggtcaaggaagtcgggctgaaggtgccgctggtggtgcgcctggaa
ggcaccaatgccgagctcggcaagaagatcatcaacgacagcggcttgaacgtggtgtcg
gcggacgatctcgacgacgcggccaagaagatcgtgtcggcggtgaagggctga

DBGET integrated database retrieval system