KEGG   Mesorhizobium opportunistum: Mesop_1031Help
Entry
Mesop_1031        CDS       T01542                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mop  Mesorhizobium opportunistum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesop_1031
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesop_1031
  Amino acid metabolism
   00310 Lysine degradation
    Mesop_1031
Enzymes [BR:mop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mesop_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1079429..1080721
Genome map
AA seq 430 aa AA seqDB search
MATEIRVPTLGESVTEATIGKWFKKVGDAIAVDEPLVELETDKVTVEVPAAAAGTLGEIT
AKEGETVGVGALLGMISAGGAGAAPANKQEAKPQAVAQASSPDAAHTTKQAAAETARIAG
DAGPVEPRTMPPAPAAAKLIAENNLSVDQLSGSGKRGQVLKGDVLDAISKGAPSQPAETP
KAAPAPVAMRAPSSGDDASREERVRMTKLRQTIARRLKEAQSTAAMLTTFNEVDMSAVMA
LRTKYKDVFEKKHGVKLGFMGFFTKAVTHALKEIPSVNAEIDGTDIIFKNYAHIGVAVGT
EKGLVVPVVRDADQMSIAEIEKEIGRLGIAARDGKLSVADMQGGTFTISNGGVYGSLMST
PILNAPQSGILGMHKIQDRPVVVGGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESL
EDPERLVLDL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaaatccgcgttcccactctcggcgaatccgtcaccgaggcgaccattggc
aaatggttcaagaaggtcggcgatgccattgccgtcgacgagccgctggtcgagctcgaa
accgacaaggtgacggtggaggttccggccgccgccgcaggcacgctgggcgagatcacc
gccaaggaaggcgagacggtcggcgtcggcgccttgctggggatgatttcggcgggcggt
gctggcgctgcccccgcgaacaagcaggaggccaagccccaagcggtggcgcaggcgtcg
agccccgacgcggcgcacaccaccaagcaggccgccgccgagaccgccaggatcgccggc
gatgccggcccggtcgagccgcgcaccatgccgcccgcgccggccgccgccaaactgatc
gccgagaacaatctgtctgttgatcagctttccggctcgggcaagcgcggccaggtgttg
aagggcgacgtgctcgatgctatctcgaagggcgcgccgtcgcagccggccgagacgccg
aaggcggcaccagcaccggttgccatgcgtgcgccatcctccggcgacgacgcctcgcgc
gaggagcgcgtgcggatgaccaaattgcgccagaccatcgcgcgccggctcaaggaagcg
caatcgaccgcagccatgctgaccaccttcaacgaggtcgacatgtcggcggtgatggcg
ctgaggaccaagtacaaggacgtgttcgagaagaagcacggcgtgaagctcggcttcatg
ggcttcttcaccaaggccgtcacccacgcgctgaaggaaatcccctcggtcaatgccgag
atcgacggcaccgacatcatcttcaagaactacgcccatatcggcgtcgccgtcggcacc
gagaagggcctggtcgtgccggtcgtgcgtgatgccgaccagatgtcgatcgccgagatc
gagaaggagatcggccggctgggcatcgccgcgcgcgacggcaagctgtcggtcgccgac
atgcagggcggcacgttcaccatctccaatggcggcgtttacgggtcgctgatgtcgacg
ccgatcctcaacgcgccgcagtcgggcattctgggcatgcacaagatccaggaccggccg
gtggtggtcggtggccagatcgtgatccggccgatgatgtatttggcgctgagctacgac
caccgcatcgtcgacggcaaggaagcggtgaccttcctggtgcgagtcaaggaaagcctg
gaggatccggaacggctggtgctggatttgtga

DBGET integrated database retrieval system