KEGG   Mesorhizobium opportunistum: Mesop_1056Help
Entry
Mesop_1056        CDS       T01542                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mop  Mesorhizobium opportunistum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesop_1056
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesop_1056
   00650 Butanoate metabolism
    Mesop_1056
  Energy metabolism
   00190 Oxidative phosphorylation
    Mesop_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1101049..1101444
Genome map
AA seq 131 aa AA seqDB search
MSTGKTDMRTPLARVRGLGSAREGTGHFWRQRLTAIANIPLILFFVGFLIALNGAGFAEV
RAALANPFVALVVALVLVSGLIHMRIGMQVIIEDYVHGEGMKLALIALNTFFTVAVGVTS
IFALLKLAFGG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgagcactggcaagaccgacatgcgcacgccgctggccagggtccgcggcctgggttcc
gcccgcgaaggcaccggacatttctggcgccagcgcctaaccgcgatcgccaacatcccg
ctgatcctgtttttcgtcgggttcctgatcgcgctcaacggcgccggttttgcggaggtg
cgggcagcgcttgccaatccgttcgtggcgctggtggtggccctggtgctggtctccggg
ctgatccatatgcgtatcggcatgcaggtgatcatcgaggattacgtgcatggcgaaggc
atgaagctggcgctcatcgcgctcaatacttttttcaccgtagcggtcggcgtcacctcg
atcttcgccctgctcaagctggcattcggaggctga

DBGET integrated database retrieval system