KEGG   Mesorhizobium opportunistum: Mesop_1169Help
Entry
Mesop_1169        CDS       T01542                                 

Definition
Alkaline phosphatase D-like protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mop  Mesorhizobium opportunistum
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mop00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:mop00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mop02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1209364..1210971
Genome map
AA seq 535 aa AA seqDB search
MATFNAIQETAMNKLSMTRRAFVTSASAAGLVGVSSLALPYYSRANQRPAFTHGVQSGDV
DATSGMVWTRTDRPSRVMFEVSSTENFANAIRLAPLDTSPASDYTVRRLLTDLASDQDIF
YRMTAADLADINAVSEPIVGRFRTAPASKRDIKFAWSGDTAGQGWGIDETGMKTYATIGK
HTPDFFLHSGDTIYADGAMKDEVDLPGGGKWKNVVLVDGKRKVAETLDEYRDQWKYNMMD
RHVLGLSAICPTFYQWDDHEVLNNWSDSKNLSADDRYTEKSIHVLAARAARAFHEMTTIR
YEPSEPGRVYRKIAYGPLLDVFFLDMRSYRGPNGPDMQDEMTPQSRMLGEQQTKWLKREL
ANSKATWKIIAADMPLGLVVWDDGVKKAGAEAVSNGDNGLPKGRELEIADLLRYIKNAGI
SNTVWLTADVHYTAAHYYNPEKAQFQDFSPFWEFVSGPIHAGTFGPNDFDMTFGPELKFI
KAPTAEQGQNLPPSAGLQFFGLVDISGATEQMTVRLMDRDDNELYKITLDPVRSA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
gtggcaacgttcaacgccatccaggagacagccatgaacaagctctcgatgactcgccgc
gcttttgtcacctccgccagcgccgctggtctggtcggcgtttccagcctggcgctgccc
tattattctcgcgccaaccagcgcccggccttcacccatggcgtccagtcgggggatgtc
gacgccaccagcggcatggtgtggacgcgcacggatcgcccgtcgcgtgtcatgttcgaa
gtgtcgtcgaccgagaatttcgccaacgcgatccggctggcgccgctcgatacgtcgccg
gccagcgattatacggtcagacgcctgctcaccgatctcgcttccgatcaggacatcttc
taccgcatgacggcagccgacctcgctgacatcaacgccgtctccgagccgatcgtcggc
cgcttccgcaccgcgccggcctcgaagcgcgacatcaagttcgcttggtcgggcgacacc
gccggccagggctggggcatcgacgagaccggcatgaagacctacgccacgatcggcaag
catacgcccgatttcttcctgcattcgggcgacaccatctatgccgacggcgcgatgaag
gacgaggtcgacctgcccggcggcggcaagtggaagaacgtcgtgctagtcgatggtaag
cgcaaggtcgccgagacgctggacgaataccgcgaccagtggaaatacaacatgatggac
agacacgtcctgggtctcagcgccatctgcccgaccttttatcagtgggacgaccacgag
gtgctgaacaactggtcggattcgaaaaatctgagcgccgacgatcgctacacggaaaaa
tccatccatgtgctggcggcccgcgcggcccgagccttccatgagatgacgacgatccgt
tacgagccgtcggagcccggccgcgtctaccgcaagatagcctacgggccgctgctcgac
gtgttcttcctcgacatgcgctcctatcgcggccccaacggtccggacatgcaggatgag
atgacaccgcaatcgcgcatgctgggcgaacagcagacgaaatggctgaagcgggagcta
gccaactccaaggcgacatggaagatcatcgccgcagacatgccgctcggcctcgtcgtc
tgggacgatggcgtcaaaaaggcaggcgcggaggctgtcagcaatggtgacaacggtctg
ccaaagggacgcgagctggagatcgccgacctgctgcgctacatcaagaatgccggcatc
agcaacaccgtctggctcaccgccgacgtgcactacacagccgcgcattactacaatccc
gagaaggcgcagttccaggacttcagtccattctgggaattcgtctccggccccatccat
gccggaaccttcggcccgaacgatttcgacatgaccttcggtccggagctgaagttcatc
aaggcgccgacagccgagcaggggcagaacctgccgccgtcagccggcctgcaattcttt
ggccttgtcgacatttccggcgccaccgagcagatgaccgtgcggctgatggatcgcgac
gacaacgaactctacaagatcacgctcgacccggtacggtcggcgtaa

DBGET integrated database retrieval system