KEGG   Mesorhizobium opportunistum: Mesop_1262Help
Entry
Mesop_1262        CDS       T01542                                 

Definition
4-hydroxyproline epimerase (EC:5.1.1.8)
Orthology
K12658  
4-hydroxyproline epimerase [EC:5.1.1.8]
Organism
mop  Mesorhizobium opportunistum
Pathway
Arginine and proline metabolism
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mop00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1312845..1313846
Genome map
AA seq 333 aa AA seqDB search
MAKKSFFCIDGHTCGNPVRLVAGGGPLLQGSTMMERRAHFLAEYDWIRTGLMFEPRGHDV
MSGSILYPPTREDCDIAILFIETSGCLPMCGHGTIGTVTMAIEHELIKPKTPGVLRLDTP
AGLVIAEYKQVGEYVEEVRITNVPSFLHAEGLTVECPGLGEITVDVAYGGNFYAIVEPQA
NYRDMADYSAGDFIAWSPVVRQRLNEKYTFVHSENPGINRLSHMLWTGNPTVAGADARNA
VFYGDKAIDRSPCGTGTSARMAQLHAKGKLKAGDSFVHESIIGSLFKGKVEKEVTVAGKP
AIVPSIGGWARTTGLNTIFIDDRDPFAHGFIVK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaatccttcttctgcatcgacggccacacctgcggcaatccggtgcggctg
gtcgccggcggcggaccattgctgcagggttcgacgatgatggaacggcgcgcgcatttc
ctcgccgagtatgactggatccgtaccggattgatgttcgagccgcgcggtcacgacgtg
atgtccggctcgatcctctacccgccgacgcgcgaggattgcgacatcgccatcctgttc
atcgaaacctccggctgcctgccgatgtgcggccacggcaccatcggcacggtgacgatg
gcgatcgagcacgaactgatcaagccgaagacgccgggcgtgctgaggctcgacacgccg
gccggcctggtcatcgccgaatacaaacaggtcggcgaatatgtcgaggaggtgcgcatc
accaacgtgccgtccttcctccatgccgaaggactgacggtcgagtgtcccgggcttggc
gagatcaccgtcgatgtcgcctatggcggcaatttctacgccatcgtcgagccgcaggcg
aactaccgcgacatggccgactattccgccggcgacttcatcgcctggagtcccgtggtg
cggcagcgactcaacgagaaatacactttcgtgcattcggagaacccaggcatcaacagg
ctgtcgcacatgctgtggaccggcaaccccacggtcgcgggagccgacgcccgcaacgcc
gtcttctacggcgacaaggcgatcgaccgctcaccctgcggcacaggcacctcggcacgc
atggcgcagcttcacgcaaagggcaagctcaaggccggcgacagcttcgtccatgaatcg
atcatcggctcgctgttcaagggcaaggtcgaaaaggaggtcacggtcgcgggaaagccg
gcgatcgttccctcgatcggcggctgggcgcgcacgaccggattgaacacgatcttcatc
gatgaccgcgatccgttcgcgcatgggttcatcgtcaaatag

DBGET integrated database retrieval system