KEGG   Mesorhizobium opportunistum: Mesop_1394Help
Entry
Mesop_1394        CDS       T01542                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mop  Mesorhizobium opportunistum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mesop_1394
Enzymes [BR:mop01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mesop_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1443796..1444755
Genome map
AA seq 319 aa AA seqDB search
MSKLTVTPRTVFQTFLDFPLVEDLDTLSADVVIIGMPYGAPYTIDETINDQTNAPTAVRR
ASQRISLGLDRYDFDIGGTLFDGRDVKVVDVGDVPGEASDSTGHYARAEAAIRKIRAAGA
LPITIGGDHGIPIPIFRALDGEGPITLVQIDAHLDWRDNVNGVKEGYSSPIRRASEMAHI
DAIFQLGIRGQGSARMEEVEAARAYGSNIITAGQWQDIGTAALLERIPEGGRYYLTIDAD
GLDPAVMPAVEGPSPGGVTYRQTIDLIKGLFAKGEVVGVDIVEIAPARDINEITSMTAGN
IILNVIGAAVRAGQFKRQN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagctgaccgtcacgccgcgcaccgtcttccagacattcctggactttccgctg
gtcgaggacctcgacacgctgagcgccgatgtcgtcatcatcggcatgccctacggcgcg
ccctatacgatcgacgagacgatcaacgaccagaccaatgcgccgaccgcggtgcggcgt
gcctcgcagcgtatcagccttgggctcgatcgctatgatttcgacattggcggtaccctg
ttcgacgggcgggacgtcaaggtggtcgatgtcggcgacgtgccgggcgaagcatccgat
tccaccgggcattacgccagagccgaggcggcgatccgcaagatacgcgccgccggcgcg
ctgccgatcaccatcggcggcgaccacggcattccgatcccgatcttcagggcgctcgat
ggcgaggggccgatcacgctggtgcagatcgatgcccatctcgactggcgcgacaatgtc
aacggcgtcaaggaaggctattccagcccgatccgacgggcatccgaaatggcgcatatc
gacgcgatcttccagctcggcattcgcggccagggcagcgcccgaatggaagaagtcgaa
gcggcacgcgcctacggctccaacatcatcaccgctggccagtggcaggacatcggcacg
gcggccctgctcgagcgcattcccgagggcggccgttactacctcacgatcgacgccgac
ggtctcgatccggccgttatgccggcggtggagggaccgtcgccgggtggcgtcacctat
cgccagacgatcgacctgatcaaggggctgttcgccaagggagaagtggtcggcgtcgac
atcgtcgagatcgcgccggcacgcgatatcaacgagatcacgtcgatgacggcaggcaac
atcatcctcaatgtcatcggtgccgccgttcgcgctggtcaattcaagcgccagaactga

DBGET integrated database retrieval system