KEGG   Mesorhizobium opportunistum: Mesop_1503Help
Entry
Mesop_1503        CDS       T01542                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mop  Mesorhizobium opportunistum
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mop00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:mop00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1550008..1550826
Genome map
AA seq 272 aa AA seqDB search
MFPPTSREITMGSLSSKNALVTGSTSGIGLAIARAFAAEGANVTINGLGDAAAIEQERAG
IEKDFGVKCRYSDANMMDGAAVSAMVHDAEAAFGSLDILVNNAGIQHVAPIEDFPDDKWE
AIIRINLLAAFYAIKAVVPGMKARKWGRIINTASAHALVASPFKSAYVSAKHGIAGLTKT
VALETAQDGITVNAIAPGYVWTPLVEKQIPDTMKARGMTEEQVKHDVLLAAQPTKEFVTV
EELAALTLFLCSDSARQITGTTLPMDGGWTAQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgttccctcccacttcgcgcgagatcaccatgggttccctgtcttcgaagaatgccctc
gtcaccggctcgaccagcggtatcggcctggccatcgcccgcgcctttgccgccgaaggc
gccaacgtcaccatcaatggccttggcgatgccgccgcgatcgagcaggaacgcgccggc
atcgagaaggatttcggcgtcaagtgccgctattccgatgccaacatgatggatggggct
gcggtgagcgccatggtgcacgacgccgaggccgcgttcggcagtctcgatatcctggtc
aacaatgccggcatccagcatgtcgcgccgatcgaggactttcccgacgacaagtgggaa
gcgatcatccgcatcaatcttctggcagccttctatgccatcaaggcggtggtgcccggc
atgaaggcgcgcaaatggggccgcatcatcaacacggcgtcggcgcatgcgctggtcgcc
tcgccgttcaagtcggcttatgtctcggccaagcacggcattgcaggcctgaccaagacg
gtggcgctggaaaccgcgcaggacggcatcaccgtcaacgcgatcgcgccgggctatgtc
tggacgccgctggtcgaaaagcagatccccgacacgatgaaggcgcgcggcatgaccgag
gagcaggtcaagcacgacgtgttgctcgccgcacagccgacgaaggaattcgtcaccgtc
gaggagcttgcggcgctgacgctgttcctgtgctcggattcagccaggcagatcaccggg
acgaccttgccaatggacggcggctggacggcacagtag

DBGET integrated database retrieval system