KEGG   Mesorhizobium opportunistum: Mesop_1503Help
Entry
Mesop_1503        CDS       T01542                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mop  Mesorhizobium opportunistum
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Mesop_1503
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Mesop_1503
Enzymes [BR:mop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Mesop_1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1550008..1550826
Genome map
AA seq 272 aa AA seqDB search
MFPPTSREITMGSLSSKNALVTGSTSGIGLAIARAFAAEGANVTINGLGDAAAIEQERAG
IEKDFGVKCRYSDANMMDGAAVSAMVHDAEAAFGSLDILVNNAGIQHVAPIEDFPDDKWE
AIIRINLLAAFYAIKAVVPGMKARKWGRIINTASAHALVASPFKSAYVSAKHGIAGLTKT
VALETAQDGITVNAIAPGYVWTPLVEKQIPDTMKARGMTEEQVKHDVLLAAQPTKEFVTV
EELAALTLFLCSDSARQITGTTLPMDGGWTAQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgttccctcccacttcgcgcgagatcaccatgggttccctgtcttcgaagaatgccctc
gtcaccggctcgaccagcggtatcggcctggccatcgcccgcgcctttgccgccgaaggc
gccaacgtcaccatcaatggccttggcgatgccgccgcgatcgagcaggaacgcgccggc
atcgagaaggatttcggcgtcaagtgccgctattccgatgccaacatgatggatggggct
gcggtgagcgccatggtgcacgacgccgaggccgcgttcggcagtctcgatatcctggtc
aacaatgccggcatccagcatgtcgcgccgatcgaggactttcccgacgacaagtgggaa
gcgatcatccgcatcaatcttctggcagccttctatgccatcaaggcggtggtgcccggc
atgaaggcgcgcaaatggggccgcatcatcaacacggcgtcggcgcatgcgctggtcgcc
tcgccgttcaagtcggcttatgtctcggccaagcacggcattgcaggcctgaccaagacg
gtggcgctggaaaccgcgcaggacggcatcaccgtcaacgcgatcgcgccgggctatgtc
tggacgccgctggtcgaaaagcagatccccgacacgatgaaggcgcgcggcatgaccgag
gagcaggtcaagcacgacgtgttgctcgccgcacagccgacgaaggaattcgtcaccgtc
gaggagcttgcggcgctgacgctgttcctgtgctcggattcagccaggcagatcaccggg
acgaccttgccaatggacggcggctggacggcacagtag

DBGET integrated database retrieval system