KEGG   Mesorhizobium opportunistum: Mesop_1675Help
Entry
Mesop_1675        CDS       T01542                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mop  Mesorhizobium opportunistum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesop_1675
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesop_1675
   00052 Galactose metabolism
    Mesop_1675
   00500 Starch and sucrose metabolism
    Mesop_1675
   00520 Amino sugar and nucleotide sugar metabolism
    Mesop_1675
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mesop_1675
   00524 Butirosin and neomycin biosynthesis
    Mesop_1675
Enzymes [BR:mop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mesop_1675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1744359..1745828)
Genome map
AA seq 489 aa AA seqDB search
MQDVMPLSIGIDIGGTNLRAARVSGTGEILKRVSEKSAPDPELVLGRIADMVRLLDTPDV
KAIGVGVPGRVDARRGAVLSGGYVNLASVALAQRLEDMTGKPVIIDNDCNMALAAEMALG
AGRGHDNIVMFTIGTGIGGAVAQDRLITRGSATAGQLGHITVDVDGEFCACGRRGCVETT
SSGTALGRHIARAGLGADISVDQLFARDAAGDIQARGILDAWARPLRAAIDTAVAVLDPD
MVLLGGGLGRAAHTALGRAPALAPWYQCPVEPAQLGDDAGVIGAGLQALAVGPGAGTSPR
LAQSSHARRAVLVNGIPASGKSTVSRGIADRMGWPLLALDTIKNPFLEVLGGGDREFNRT
LGRASYQAIWSAVGEAPAGSTFVIDAWFGFQPREVLEDHLRKAGVEQTFEIWCHAPGEVL
AERYGVRLDQRPAGHPGAAYIPELIELARRAEPLRRGPLFDVDTTKPIDFDAISAWLRAV
MAARLDVPG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgtcatgcccctcagcatagggatcgatataggcggcaccaatctgcgcgcc
gcccgcgtctccgggaccggtgaaatcctcaagcgcgtttccgaaaagagtgcgcccgac
ccggagctggtgcttggccgcatcgccgacatggtgcgccttctcgacacgcccgatgtg
aaggccatcggcgtcggcgtccccggccgtgtcgatgcgcggcgcggcgccgtcctgtcg
ggtggctacgtcaacctcgcttcggtcgcgctggcgcaacgcctggaagacatgacaggc
aagcccgtcatcatcgacaacgactgcaacatggcgttggccgccgagatggcgctcggc
gccgggcgcggccatgacaacatcgtcatgttcaccataggcaccggcattggcggcgcc
gtcgctcaagatcgcctgattacgcgtggctcggcaacggcgggccagcttggccacatc
accgtcgatgtcgacggcgagttttgcgcctgcggccggcgcggctgcgtcgagaccacc
agttcaggcaccgcgctcggccgccacattgcgcgcgccgggctcggcgccgacatttct
gtcgatcagctttttgcccgcgatgcggccggcgacatccaggcgcgcggcatactcgac
gcctgggcgagaccgctgcgtgccgccatcgacacggccgttgccgtgctcgatcccgac
atggtgctgcttggcggcggccttggccgggcagcacatacagctctcggccgagcgccg
gcgctggcgccctggtaccaatgcccggtggaacccgcgcagctcggcgacgacgccggt
gtgatcggcgctggcctccaggcgctcgccgtgggaccgggcgcaggtacgtctccgcgc
ttggcccagtccagccacgccaggcgtgccgtgctcgtcaacggcattcccgcaagcggc
aagagcaccgtctcgcgcggcatcgccgaccgcatgggatggccgttgctcgcgctcgac
acgatcaagaatccgttcctcgaagtgcttggcggcggcgaccgcgaattcaaccgcacg
ctcggccgcgccagctatcaggcgatctggtcggccgtcggcgaagcgccagcgggcagc
acctttgtcatcgatgcctggttcggcttccagccgcgtgaagtcctcgaggaccatctg
cgaaaagctggcgtcgaacagaccttcgaaatctggtgccacgcgcccggggaggtcctt
gccgagcgctatggcgtccggctcgaccagcgccccgctggtcatcccggcgccgcctat
atccccgaactgatagaactcgccaggcgcgccgaaccgctgcggcgcggaccgctcttc
gacgtcgacacgacaaaaccgatcgacttcgatgccatctcggcatggctgcgggcggtc
atggccgcccgcttggatgtacctggctga

DBGET integrated database retrieval system