KEGG   Mesorhizobium opportunistum: Mesop_1831Help
Entry
Mesop_1831        CDS       T01542                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00240  Pyrimidine metabolism
mop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mesop_1831
Enzymes [BR:mop01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mesop_1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AEH86312
UniProt: F7Y6R3
Position
complement(1903803..1905122)
Genome map
AA seq 439 aa AA seqDB search
MLPQEIIRHKRDGQRLPAREIAAFIDGVTSGAVTDGQVAAFAMAVFFNGMSRDEAVASTL
AMRDSGDVLDWSDLPGPVTDKHSTGGVGDNVSLMLAPIVAACGAYVPMISGRGLGHTGGT
LDKMDAIPGYASQPDIALFRKAVLETGCAIIGQTADLAPADRRLYAIRDVTGTVESVPLI
TASILSKKLAAGLGSLVLDVKVGNGAFMEKSRDATALANSLVEVASGAGLKVSALITGMN
EPLASAAGNAVEVRNAVDFLTGRFRDRRLEDVTLALAAEMLQSAGLVSSNQDGMRRATET
LVSGRAAATFARMVSVLGGPADFIERPEKYLAEAATEFAVKATTDGFVTGIATRDIGLAV
VGLGGGRTRPDDKIDPAVGITRLLPIGAEVGAGEPLALVHARSPSDAEAAAATVLSAYTI
GASKPPADKTVMRRILARG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcttccgcaggaaatcatccgccacaagcgcgacggccagaggctgccggctcgtgag
atcgctgccttcatcgacggcgtgacgtcgggcgccgtcaccgatggccaggtcgcggct
tttgccatggcggtgttcttcaacggcatgagccgcgacgaggccgtggcgtcgacactg
gccatgcgcgattccggcgacgtgctcgactggtcggatctgccgggtcccgtcaccgac
aagcattcgacgggcggcgtcggcgacaatgtctcgctgatgctggcgccgatcgttgcc
gcctgcggcgcctatgtaccgatgatctcgggccgtggcctcggccatacaggcggcaca
ctggacaagatggatgccatccccggctatgccagccagcccgatatcgcgctgtttcgc
aaggcggtgctggaaacgggttgcgccatcatcggccagaccgccgatctcgcgccggcg
gaccgccggctttacgccatccgcgacgtcaccggaaccgtggaatcggtgccgctgatc
accgcctcgatcctgtcgaagaagctggccgccggcctcggctcgctggtgctcgacgtc
aaggtcggcaacggcgccttcatggagaagtcgcgcgacgcgacagcgctcgccaacagt
ctggtcgaggtcgccagcggcgcgggattgaaggtctcggcgttgatcaccggcatgaac
gaaccgctggcgtccgccgccggcaatgccgtcgaggtgcgcaacgccgtcgatttcctg
accggccgttttcgcgaccggcggctggaggatgtgacgctggcgctggcggccgaaatg
ctgcagtcggcgggactggtatcatccaaccaggatggcatgcggcgcgccacggagacg
cttgtcagcggccgcgccgccgccaccttcgcgcgcatggtttcggtgctcggcggcccc
gccgatttcatcgagagaccggaaaaatacctggctgaggcggcaaccgaatttgcggtc
aaggcaacgaccgacggcttcgtcaccggcatcgccacccgcgatatcggcctggcggtg
gttggcctgggcggcgggcgcacgcggccggacgacaagatcgatccggcggtcggcatc
accaggctgctgcccatcggcgccgaggtgggggctggcgagccgctggcgctggtgcat
gcccgctcgccatccgatgccgaggccgccgccgcaaccgtgctttccgcctacaccatt
ggggcttcgaaaccaccggcggataaaaccgtcatgcggcggattctggcgcgcggttga

DBGET integrated database retrieval system