KEGG   Mesorhizobium opportunistum: Mesop_1917Help
Entry
Mesop_1917        CDS       T01542                                 

Definition
Lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
mop  Mesorhizobium opportunistum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mesop_1917
Enzymes [BR:mop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Mesop_1917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1992595..1993599)
Genome map
AA seq 334 aa AA seqDB search
MKTPSTKRRMTDILQDTSLFHETEGNPRPENAAGGFFTARDRKKIRYGLFGAVARPMRGT
VVLLPGRNECIEKYFETIRDLAARGLGVATLDWRGQGGSDRLIGDRQRGYVRSFRDYTAD
LEQFFEEIVLPDCRGPYYILAHSAGAVITLLAAPSMVNRVRRMVLIAPFLTLPDLPVSIS
TVRRVCSFFCALGLGRLYAAWGPLPRDTLPFEANKVTSDPQRYRRNTRIYEGYPQLALGG
PTIRWLQAAAKASEAISDPDFMARIQVPLLIIAAGADQVVSTRAVEAYARSLRLGSMLMI
DGAKHEILQEADLYREQFLAAFDAFVPGSDDPTA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacgccgagcacaaagcgccgtatgacggacatcctccaagacacctcccttttc
catgagactgagggcaatccgcggccggagaacgccgccggcggctttttcaccgcgcgc
gatcgcaagaagatccgctatggcctgttcggagcggtcgcgcgcccgatgagaggcacc
gtggtgctgctgccaggccgcaacgagtgcatcgagaaatatttcgaaaccatccgcgat
cttgccgcccggggacttggcgtcgccacgctcgactggcgcggccagggcggttccgac
cggctgatcggcgatcgccagcgcggttatgtcaggtccttccgcgattatacggccgac
ctcgagcagttcttcgaggagatcgtgctgcccgactgccgtggaccctactacatcctg
gctcattccgccggcgcggtgatcacgctgcttgcggcgccgtcgatggtcaaccgcgtg
cggcgcatggtgctgatcgcgccgttcctgacgctgcccgacctgccggtctcgataagc
accgttcgccgcgtctgttcgtttttctgcgctttgggccttggcaggctctatgccgcc
tggggcccactgccgagagacacgctgcctttcgaagccaacaaggtgacgtcggatcca
cagcgctatcgtcgcaacacccgcatctatgaagggtatccgcaactggccctcggcggc
ccgacgatccgttggctgcaggcggcggcaaaggcttcggaagcgatcagcgatcccgac
ttcatggccaggatccaggttcccctgctgatcatcgccgccggcgccgaccaggtcgtc
tcgaccagggcggtggaagcatacgccagaagtctgaggctcggctcgatgctgatgatc
gacggcgccaagcacgaaatcctgcaggaggccgacctctaccgcgaacaattcctcgcc
gccttcgatgccttcgttcccggctccgacgacccgacggcctga

DBGET integrated database retrieval system