KEGG   Mesorhizobium opportunistum: Mesop_1928Help
Entry
Mesop_1928        CDS       T01542                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mop  Mesorhizobium opportunistum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mesop_1928
   00052 Galactose metabolism
    Mesop_1928
   00500 Starch and sucrose metabolism
    Mesop_1928
   00520 Amino sugar and nucleotide sugar metabolism
    Mesop_1928
Enzymes [BR:mop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mesop_1928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2010240..2011145
Genome map
AA seq 301 aa AA seqDB search
MKRVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDRPVIQYVVDEAREAGIEHFIFVTGRN
KAVIEDHFDIQFELYDTLAQRGKDEQLARLQRLQPAPGQTSFTRQQVPMGLGHAVWCARE
LVGDEPFALLLPDMIMQSEKSCMKEMVDLYAETGNNIIAVQECDPAEAHKYGIVGRGEPT
HHGFRITEMVEKPKTGTAPSNLYINGRYILQPEIFKILEGQEKGAGNEIQLTDAMLKLEK
QQAFYGYHYQGRTFDCGSPEGFVEANVAFALWRSDMNHSMATVIRTLLDEMKPSERRGAA
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagttcgcaaggcagtttttccagtcgctggtctcggcacgcggtttctcccc
gccaccaaggctgttcccaaggaaatgctgaccgtcgtcgaccggccggtcatccagtat
gtggtggatgaggcgcgcgaggcgggcatcgaacatttcatcttcgtcaccggccgcaac
aaggcggtcatcgaggatcatttcgatatccagttcgagctctatgacaccctcgcccag
cgcggcaaggacgagcagcttgcccggttgcagcggctgcagccggcgccgggacagacc
agcttcacgcgccagcaggtgccgatggggcttggccatgccgtctggtgcgcgcgcgaa
ctggtcggcgacgagccgttcgcgctgctgttgcccgacatgatcatgcagtcggaaaag
agctgcatgaaggagatggtcgatctttacgccgagaccggcaacaacatcatcgccgtg
caggagtgcgatccggccgaagcccataaatacggcattgtcggccggggcgaaccgacc
catcacggcttccgcatcaccgaaatggtcgagaagccaaagacgggcaccgcgccgtcg
aacctgtacatcaacggccgctacatcctgcagcccgagatcttcaagatcctcgaaggg
caggagaagggcgccggcaacgagatccagctcaccgacgcgatgctgaagctggagaag
cagcaggccttctacggctaccactatcagggccgcaccttcgactgcggctccccggaa
ggcttcgtcgaggccaatgtcgccttcgcgctgtggcgaagcgacatgaaccacagcatg
gccaccgtcatccgcacgcttctcgacgagatgaagccatcagagcggcgcggggcagca
ttctag

DBGET integrated database retrieval system