KEGG   Mesorhizobium opportunistum: Mesop_2236Help
Entry
Mesop_2236        CDS       T01542                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
mop  Mesorhizobium opportunistum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mop00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mop02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2335149..2335538)
Genome map
AA seq 129 aa AA seqDB search
MLRAVSSASILLLATSIAAHAGGDPVQGKHVFNRCIACHEAATDRDKVGPHLMGVVGRTA
GSAESFLGHYSEAMKNAGAAGLVWDEANLAEYLKAPRLKVPGNKMAFGGLGSDDDIANVI
AYLKADPKP
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgagccgtttcgtcagccagcatccttctgctggccacctccattgccgctcac
gccggcggcgaccccgtgcagggcaagcacgtcttcaaccgctgcatcgcctgccatgaa
gcggccaccgaccgcgacaaggtcggcccgcatttgatgggtgtcgtcggtcgcaccgcg
ggcagcgccgaaagcttccttggccactattcggaagccatgaaaaacgccggcgccgcc
ggtctcgtctgggacgaggcaaaccttgccgaatacctcaaggcgcccaggctgaaggtg
cccggcaacaagatggctttcggcggcctcggcagcgacgacgacatcgccaacgtcatc
gcctatctgaaggccgatcccaagccctga

DBGET integrated database retrieval system