KEGG   Mesorhizobium opportunistum: Mesop_2424Help
Entry
Mesop_2424        CDS       T01542                                 

Definition
type 11 methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mop  Mesorhizobium opportunistum
Brite
Enzymes [BR:mop01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mesop_2424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2512979..2513833)
Genome map
AA seq 284 aa AA seqDB search
MSNIEDIRKFYARLMAANAASPDPRLEEVFAEVPREAFLGPGPWTIIAGNGKVTTPSADP
AHLYQNVLVVLDADKGINNGEPFLHAMWIGKLAPKPGEAVSHIGAGTGYYTALLARLVSP
DGTVTAFELDGRLADLARKNLEAYGNATAVHGDAVTAPLPPSDIIYVNAGVVAPPAGWLE
ALRPGGRMIFPWRPAERVPLAVMVTRTEKGLACDPFMRSWFIPCFGASVAELAAKIPTRD
EATRSRSIWLTKDKPPDRTATAIFSDVWFSSKGLDAAPRARSRK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatcgaggatatcaggaaattctacgcgcggctgatggcggccaatgccgcc
tcgcccgacccgcgcctggaagaggtgttcgccgaggtgccgcgcgaagccttcctcggc
ccagggccgtggacgatcatcgccggcaacggcaaggtcacgacgccgagcgccgacccg
gcgcacctctaccagaacgtgctggtggtgctcgatgccgacaagggcatcaacaatggc
gagccgttcctgcacgccatgtggatcgggaagctggcgccgaagcccggcgaggccgtt
tctcacatcggcgctggtaccggctactacaccgccttgctggccaggctggtttcacct
gacggcaccgtcaccgccttcgaactcgacggcaggctggccgacctggcacgcaagaat
ctcgaagcctatggcaacgcgaccgccgtccatggcgatgccgtgaccgcgcccttgccg
ccatccgatatcatctatgtcaacgccggcgtcgtcgcccctccggccggatggctggag
gcgttgcgcccaggcggccgcatgatctttccctggcgcccggccgagcgcgtgccgctg
gcggtgatggtgacccgtaccgaaaagggcctcgcctgcgatcccttcatgcgctcctgg
ttcatcccatgcttcggtgcctcggttgcggagcttgccgcaaaaattccgacccgcgac
gaggcgacgcgcagccgctcgatctggctgaccaaggacaagccaccggaccgcacggcc
accgcgatcttcagcgacgtctggttctcgtcgaaaggtctcgatgcggcaccgcgcgcc
agatcccggaaatga

DBGET integrated database retrieval system