KEGG   Mesorhizobium opportunistum: Mesop_2501Help
Entry
Mesop_2501        CDS       T01542                                 

Definition
glycoside hydrolase family protein (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
mop  Mesorhizobium opportunistum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mop00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mop00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mop00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2588422..2589888
Genome map
AA seq 488 aa AA seqDB search
MSFKIAIIGAGSVGFTKKLFTDILCVPEFKDIEFALTDLSEHNLQMIKAILDRIVEANGL
PTRVTATTDRRKALEGARYIISCVRVGGLEAYADDIRIPLKYGIDQCVGDTICAGGILYG
QRNIPVILDFCKDIREVADTNAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQI
AKVLGAKSPGELDYICSGINHQTWFTDLRLNGRKIGKDELVAAFEAHPVYSQQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPDEIMRWIDMSDWIHGETGGYLRYSTETRNWFETE
YPQFLEAASKPIDVAKRSNEHASHILEALETNRVYRGHFNVKNNGVITNLPQDAIIESPG
FVDRFGINMAAGITLPEACAATCMSSINVQRMSVHAAISGDIDLLKLAVLHDPLVGAVST
PEEVWQMVDEMVVAQAAWLPQYAHAVPAAKERLSKSVVKTREWAGAARRNVRSIEELRAE
KAALKQTG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaaaatcgctattatcggcgccggcagcgttggattcaccaagaaactgttc
accgacattctctgcgtgcccgaattcaaggacatcgaattcgcgctgaccgatctcagc
gagcacaatctgcagatgatcaaggcgatcttggacaggatcgtcgaagcgaacggattg
ccgaccagggtgacggcgaccaccgaccgccgcaaggcgctcgaaggtgcgcgctatatc
atcagctgcgttcgggtcggcggcctggaagcctatgccgacgacatccgcattcccctg
aaatacggcatcgaccagtgcgtcggcgacacgatctgcgccggcggcattctctacggc
caacgcaacattccggtgatcctcgacttctgcaaggacatccgcgaggtcgccgacacc
aacgccaagttcctcaactacgccaacccgatggccatgaacacctgggcggcgatcgag
tacggcaaggtcgacacggtcgggctctgccacggcgtccagcatggtgccgagcagatc
gccaaggtgctgggcgcgaagtcgcctggggagctcgactatatctgctccggcatcaac
catcagacctggttcaccgatctgcgcctgaatggccgcaagatcggcaaggacgaactg
gttgccgccttcgaagcgcatccggtctactcgcagcaggagaagctgcgcatcgacgtg
ctgaagcgctttggcgtctattcgaccgaaagcaacggccatctgtccgaatacctgccc
tggtatcggaagcgtccggacgagatcatgcgctggatcgacatgtcggactggatccat
ggcgagaccggcggctacctccgctactcgaccgagacccgcaactggttcgagacggag
tatccgcagttccttgaagcggcgtcgaagccgatcgacgtggccaagcgctccaacgag
catgccagccacatattggaggcgctggagaccaaccgcgtctatcgcggccacttcaac
gtcaagaacaatggtgtgatcaccaatttgccgcaggacgccatcatcgagtcgcccggc
ttcgtcgatcgtttcggcatcaacatggccgccggcatcacgctgccggaggcctgtgcg
gcgacctgcatgtcttcgatcaacgtccagcgcatgtcggtccatgccgcgatatcgggc
gatatcgatctcctgaagctcgccgtgctgcatgatccgctggttggcgcggtgtcgacc
ccggaggaggtctggcagatggtcgacgaaatggtcgtcgcccaggccgcctggttgccg
caatacgcgcatgccgttccggccgccaaggagcggttgtcgaaatccgtggtcaagacc
cgcgaatgggccggtgccgcgcggcgcaacgtccgctcgatcgaggagttgcgcgccgaa
aaggccgctctgaagcagaccggctga

DBGET integrated database retrieval system