KEGG   Mesorhizobium opportunistum: Mesop_2722Help
Entry
Mesop_2722        CDS       T01542                                 

Definition
catalase/peroxidase HPI (EC:1.11.1.6)
Orthology
K03782  
catalase-peroxidase [EC:1.11.1.21]
Organism
mop  Mesorhizobium opportunistum
Pathway
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:mop00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mop00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2829502..2831712
Genome map
AA seq 736 aa AA seqDB search
MDAKTDDNSAGKCPVAHGSAGRTNRDWWPNQLDLGVLHQQSNLSDPMGEDFDYAKEFASL
DLDAVIQDLHKVMTDSQDWWPADFGHYGPLFIRMAWHSAGTYRIGDGRGGAGAGQQRFAP
LNSWPDNANLDKARRLLWPVKQKYGRKISWADLLILTGNVALESMGFKTFGFAGGRADVW
EPEQDVDWGSETKWLDDQRYSGDRELQGHLGAVQMGLIYVNPEGPNGKPDPLASARDIRE
TFGRMAMNDEETVALIAGGHTFGKTHGAGDASLVGAEPEGAGIEAQGLGWSSKYASGIAG
DAITSGLEVTWTTTPTKWSNNFFDNLFNYEWELTKSPAGAHQWTPKGGAGAGSVPDAHDP
SKRRAPAMLTTDLALRVDPAYEKISRRFHQHPDQFADAFARAWFKLTHRDMGPVVRYLGP
LVPKEELIWQDPIPAIDHELVSEQDIASLKGKILASGLSVSELVSTAWASASTFRNSDKR
GGANGARIRLAPQKDWDVNQPAELSKVLAKLEGIQKEFNAAQTGEKKISLADLIVLGGVA
AVEKAAKDGGHETKVPFTPGRMDASQEQTDVHSFAALEPKVDGFRNYVRGKQPMSVEAML
VDRAQLLSLTAPEMTVLVGGLRVLGANTGGSKHGVFTDRPGTLTNDFFVNLLSMSTVWDP
AAGSVPGAEEVYEARDRKTKAVKWTGTRADLIFGSHAQLRALAEVYGSGDAGQKFVRDFV
AAWTKVMNADRFDIAA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgaaaaccgacgacaacagcgcgggcaaatgccctgttgcgcatggatccgcc
ggccggaccaaccgtgactggtggccgaaccagctcgacctcggcgttctccaccagcag
tcgaacctgtcggacccgatgggcgaggatttcgactacgccaaggaattcgcgagcctc
gatctcgatgcggtcatccaggacctgcacaaggtcatgacggattcgcaggattggtgg
ccggcggactttggccactatggcccgcttttcatccgcatggcctggcacagcgccggc
acctaccgcatcggtgatggccgcggcggcgccggtgccggccagcagcgtttcgcaccg
ctcaacagctggccggataatgccaacctcgacaaggcgcgccggctgctttggccggtc
aagcagaaatacggccgcaagatctcctgggccgacctgctgatcctcaccggcaacgtc
gcgctggaatcgatgggcttcaagaccttcggcttcgccggcggccgcgccgacgtctgg
gaacctgagcaggacgtggactggggttctgaaaccaagtggctcgacgaccagcgctac
tccggtgatcgcgaactccagggccatctcggcgccgtgcagatgggcctgatctatgtc
aatccggaaggcccgaacggcaagcccgatccgctggcttcggcccgcgacatccgtgaa
actttcggccgcatggccatgaatgacgaggaaaccgtggcgctgatcgccggcggccac
actttcggcaagacccatggcgccggcgatgcatcgctggttggtgccgagccggaaggc
gccggcatcgaggcgcagggcctcggctggtcgagcaagtatgccagcgggattgccggc
gacgccatcacttcgggcctcgaggtgacctggacgacgacgccgaccaagtggagcaac
aacttcttcgacaatctgttcaactacgaatgggagctgacgaagagcccggcgggcgcc
catcagtggacgcccaagggcggcgccggtgccggctccgtgccggatgcgcacgacccc
tcgaagcgccgtgcgccggccatgctgaccaccgacctcgcgctgcgggtcgatccggcc
tacgagaagatctcgcggcgtttccatcagcatccagaccagttcgccgatgccttcgcc
cgcgcatggttcaagctgacgcatcgcgacatgggtccggtcgtgcgctatctcggcccg
ttggtgccgaaggaagaactgatctggcaggatccgatccccgcgatcgatcacgaactg
gtcagcgagcaggatatcgcctcgctgaaggggaagattctggcctcgggcctgtcggtt
tccgagctcgtctcgaccgcctgggcatccgcctcgacgttccgcaattccgacaagcgt
ggcggcgccaacggcgcccgtatccggctggcaccgcagaaggactgggacgtcaaccag
ccggctgaactgtcgaaggtgcttgccaagctcgaaggcatccagaaggagttcaacgcg
gcgcagacgggcgagaagaagatctcgctcgccgacctgatcgtcctcggcggcgtcgcc
gcggtcgagaaggcggcgaaggacggtggccatgagaccaaggtgccgtttacgcccggt
cgcatggacgcttcgcaggagcagacggatgtccactcctttgccgcgctcgagccgaaa
gtcgatggcttccgcaactatgtcaggggcaagcagccgatgtcggtcgaagccatgctg
gtcgaccgcgcgcaattgctgtcgctgaccgctcccgagatgacggtgctggtcggcggg
ttgcgcgttctcggcgccaacaccggcgggtcgaagcacggcgtgttcaccgacaggcct
ggcactttgaccaacgacttcttcgtcaacctgctctcgatgagcacggtctgggatccg
gcagcgggctctgttccgggtgcggaagaagtctacgaggcccgtgaccgcaagaccaag
gcggtcaaatggaccggcacccgcgccgacctgatcttcggctcgcatgcgcaactgcgt
gcgcttgccgaagtctatggatccggcgacgccggacagaaattcgtcagggatttcgtc
gccgcctggaccaaggtgatgaacgccgaccgcttcgacatcgccgcctga

DBGET integrated database retrieval system