KEGG   Mesorhizobium opportunistum: Mesop_2978Help
Entry
Mesop_2978        CDS       T01542                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00010  Glycolysis / Gluconeogenesis
mop00030  Pentose phosphate pathway
mop00051  Fructose and mannose metabolism
mop00052  Galactose metabolism
mop00230  Purine metabolism
mop00500  Starch and sucrose metabolism
mop00520  Amino sugar and nucleotide sugar metabolism
mop00521  Streptomycin biosynthesis
mop01100  Metabolic pathways
mop01110  Biosynthesis of secondary metabolites
mop01120  Microbial metabolism in diverse environments
mop01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesop_2978
   00030 Pentose phosphate pathway
    Mesop_2978
   00051 Fructose and mannose metabolism
    Mesop_2978
   00052 Galactose metabolism
    Mesop_2978
   00500 Starch and sucrose metabolism
    Mesop_2978
   00520 Amino sugar and nucleotide sugar metabolism
    Mesop_2978
  Nucleotide metabolism
   00230 Purine metabolism
    Mesop_2978
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mesop_2978
Enzymes [BR:mop01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mesop_2978
    5.4.2.8  phosphomannomutase
     Mesop_2978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_I PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AEH87432
UniProt: F7Y6W2
Position
3093132..3094652
Genome map
AA seq 506 aa AA seqDB search
MTPRIVGEALPNSFEFETAALIKPSGFREYDARWWFGHPGSAVPPELNLIGVQALGMGLG
TLIRRLGAGPDIVTGHDFRSYSLSIKLALVSGLMAAGARVRDIGLALSPMAYFAQFALET
QSVAMVTASHNENGWTGVKMGAARPLTFGPEEMSALKAIVQAGDFDLVGGGSYDFIRDFR
ATYLDDLTRDKRIARKLKVVAACGNGTAGAFAPEALQRIGCEVIPLDTELDHTFPRYNPN
PEDMQMLHAIRDKVLETGADVGLGFDGDGDRCGVVDNEGNEIFADKVGVMLARDISGQHP
GSTFVVDVKSTGLFNTDSVLKANGAVTDYWKTGHSYIKRRVAELGAVAGFEKSGHFFFNP
PIGRGYDDGLVTAIAICQMLDRNPDSSMADLYRALPLTFGTPTMSPHCADDVKYGVVERV
VSDFQAMMRDGAAFAGQKISALITVNGVRVVAEDGTWGLVRASSNKPELVVVVESPVSSQ
RRRQMFEAVDAVLRRSPEVGTYNQTF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
ttgacccccaggatcgtcggcgaggccttgcccaacagcttcgaattcgaaaccgcggcg
ctgataaagccgtccggcttccgcgaatatgacgcgcgctggtggtttggccaccccggt
tcggctgtgccgccggagctcaacttgatcggtgtccaggcgctcggcatggggcttggc
acgctgatccgccgtctcggagccggccccgacatcgtcaccgggcatgatttccgttcc
tattcgctgtcgatcaagctggcgctggtgtccggattgatggccgctggcgcacgggtg
agggatatcggcctggcgctgtcgccgatggcctatttcgcccagttcgcgctggaaacc
cagtcggtggccatggtcaccgcctcgcacaacgaaaatggctggaccggcgtcaagatg
ggagcggcgcggccactgaccttcggacccgaggagatgagcgcgctgaaggcgatcgtg
caggccggagatttcgaccttgtcggcggtggttcctatgatttcatccgcgattttcgc
gccacctatctcgacgacctgaccagggacaagcgtatcgcgcgaaagctgaaagtggtc
gccgcctgcggcaacggcaccgccggcgcctttgccccggaagcgttgcagcgcatcggc
tgcgaggtgatcccgctcgataccgaactcgaccacaccttcccgcgctacaaccccaat
cccgaagacatgcagatgctgcatgccataagggacaaggttttggagaccggcgccgat
gtcgggctgggttttgacggcgacggcgaccgctgcggcgtcgtcgacaatgaaggcaac
gagatttttgccgacaaggtcggcgtgatgctcgcgcgcgacatctccggccagcacccg
ggttcgaccttcgtggtcgacgtcaagtcgaccgggctgttcaacaccgacagcgtgctt
aaggccaatggcgccgtcaccgactactggaagaccggccactcctacatcaagcggcgt
gtcgccgaactcggcgccgtcgccggcttcgagaaatcgggacatttcttcttcaacccg
ccgatcgggcgcggctatgacgatgggctggtcacggccatcgccatctgccagatgctc
gaccgcaacccggacagctcgatggccgacctctatcgtgcgctgccactgaccttcggc
acgccgaccatgtcgccgcactgcgcggacgacgtgaagtatggcgtggtcgagcgggtg
gtctccgactttcaggcgatgatgcgcgacggcgccgctttcgccggccagaagatatcg
gccctgatcaccgtcaacggcgtgcgtgtcgtcgccgaggatggcacctgggggctggtg
cgggcgtcttcgaacaagcctgagctcgtcgtggtcgtcgaaagcccggtgtcgtcgcag
cgtcgccgccagatgttcgaggccgtcgacgccgtgctgcgccgcagccccgaagtcggc
acctacaaccagaccttttga

DBGET integrated database retrieval system