KEGG   Mesorhizobium opportunistum: Mesop_3215Help
Entry
Mesop_3215        CDS       T01542                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00010  Glycolysis / Gluconeogenesis
mop00620  Pyruvate metabolism
mop00640  Propanoate metabolism
mop00680  Methane metabolism
mop01100  Metabolic pathways
mop01110  Biosynthesis of secondary metabolites
mop01120  Microbial metabolism in diverse environments
mop01130  Biosynthesis of antibiotics
mop01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesop_3215
   00620 Pyruvate metabolism
    Mesop_3215
   00640 Propanoate metabolism
    Mesop_3215
  Energy metabolism
   00680 Methane metabolism
    Mesop_3215
Enzymes [BR:mop01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mesop_3215
Lipid biosynthesis proteins [BR:mop01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mesop_3215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEH87667
UniProt: F7YAI9
Position
complement(3323595..3325250)
Genome map
AA seq 551 aa AA seqDB search
MTRTGLPRYEDAVQHFRIEDEIARLDGDPATGINAYVECCGRHTGSNRLALRAISAGGEL
RQFSFDDLADMSGRVGNLLKQLGVGPGDVVAGMLPRIPELVALILGTWRIGAVYQPLFTA
FGPKAIEHRLGYSGAKLVVTNPANRGKLDEIETCPRVATILDPGDTLPQGDIDFRAAIAA
VSPDCEPVMRKGSDLFMMMSTSGTTGLPKGVPVPLSALLAFGAYMRDAIGLRPDDVFWNI
ADPGWAYGLYYAITGPLQLGIATTFNEGPFNARSTYEVIERLGVTSLAGSPTAFRLLLAE
GPDAAARVKGRLRVVSSAGEPLNPEVIRWFDAHLGAPIHDHYGQTENGMMVNNHHGLAHP
VRAGSAGFAMPGYRMVVLDEAGNELGPNQPGILAVDIANSPLRWFDGYHQAETPAITGGY
YRTGDTVEYEPDGSVSFIGRADDVITSSGYRIGPFDVESALIEHPAVNEAAVVGVPDPQR
TEIVKAFVILAPAYKGSEALAEELAQHVRKRLSAHAYPREIDFVTELPKTPSGKIQRFLL
RKAEVEKRKQT
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggaccggcttgccgcgctacgaggacgctgttcagcactttcgcatcgaagat
gagatcgccaggctcgacggcgacccggcgaccggcatcaatgcctatgtcgaatgctgc
ggccgccataccggcagcaaccgtctggcgctgcgcgcgatctcggccggcggcgagctc
aggcaattcagcttcgacgatctggccgatatgtcgggccgagtcggcaacctgctcaag
caactgggcgtcggccccggcgatgtcgtcgccggcatgctgccgcgcattcccgaattg
gtagcgctgatcctcggcacgtggcgcatcggcgccgtctaccagccgctgttcaccgca
ttcggcccaaaagcgatcgagcaccggctcggctacagcggcgcgaaattggtggtgacc
aatccggccaatcgcggcaagctcgacgagatcgagacctgcccgcgcgtggcaaccatt
ctcgacccaggcgataccctgccgcaaggcgacatcgattttcgtgccgccattgccgcc
gtctctcccgactgtgagccggtgatgcgcaaaggttccgacctgttcatgatgatgtct
acctcgggcacgacaggcctgcccaagggcgtgccggtgccgctcagtgcgctgctggcc
ttcggcgcctatatgcgtgacgcgatcggacttcgtccagacgatgtcttctggaacatc
gccgatcccggctgggcctatggcctctattacgccatcaccggccccctgcagctcggc
atcgccacgaccttcaacgaaggacctttcaatgccaggagcacctatgaggtcatcgag
cggctcggcgtcaccagcctggccggttcgcccaccgccttccgcctgctgctcgccgaa
ggtcccgacgccgccgctcgcgtcaagggccggctgcgcgtggtaagcagcgccggcgag
ccgctaaacccggaggtgatccgctggttcgacgcccacctcggtgcgcccatccacgat
cattacggccagaccgagaacggaatgatggtcaacaatcaccacggcctcgcgcatcct
gtccgcgcgggctctgccggctttgccatgcccggctaccgcatggtggtgctggacgag
gccggcaacgagctcggccccaaccagcctggcatccttgccgtcgacatcgccaactcg
ccgctgcgctggttcgatggctaccaccaggccgaaacgccggcgatcacgggcggctac
taccgcaccggcgacacggtggaatacgagccggacggctcggtctccttcatcggccgc
gccgacgacgtcatcacctcatcgggttaccgcatcggccccttcgatgtcgaaagcgcg
ctgatcgaacatcccgcggtcaacgaggccgccgtggttggtgtgcccgatccgcagcgc
accgagatcgtcaaggccttcgtaatcctggcgcccgcttacaagggcagcgaggcgctc
gccgaggaactggcgcagcatgtccgcaagcggctttctgcgcatgcctatccgcgcgaa
atcgatttcgtgacggaattgccgaagacgccgagcggcaagatccagcgcttcctgctg
aggaaggcggaggtggagaagcgaaagcaaacctga

DBGET integrated database retrieval system