KEGG   Mesorhizobium opportunistum: Mesop_3536Help
Entry
Mesop_3536        CDS       T01542                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mop  Mesorhizobium opportunistum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mesop_3536
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mesop_3536
Enzymes [BR:mop01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Mesop_3536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3641269..3642723
Genome map
AA seq 484 aa AA seqDB search
MKLRDLDGILPVEGTASADLEVTGISSDSRQVKPGVIFFALAGSKADGSAYAADAARRGA
VAIVTAKGSTVGGHPIPVLAVDDPRLALALGAARFFGNQPQTMVAVTGTSGKTSVAAFTR
QIWEQAGYAAASIGTTGVVAPGRNEYGSLTTPDPVALHQLLKELADAGVTHASMEASSHG
LDQRRLDGVKLAAGGFTNLGRDHMDYHPTVEDYHRAKLRLFDTLLPKGAPAVIFADDPWS
APTIQAARAAGLEVLTVGRHGDFLRLKRVEHERHRQRAEVEANGVLYEIDLPLAGDFQIS
NALVSAGLAISTGIPTAKALMSLEKLKGAPGRLDLVGTTANGAPVYVDYAHKPDALENVL
TSVRPFTTGRVMVVFGCGGDRDRGKRPIMGEIATRLADVVIVTDDNPRSEVPETIRAAIM
AAAPGAIEIGDRRKAIHDAVAMLDAGDTLIVAGKGHEEGQTIGSETLHFSDHEEVRAALR
ERAA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcagagatctagacggtatcctgccagtcgaaggaacagcttccgccgatctg
gaggttaccggcatctcgtcggattcccggcaggttaaacccggcgtcatcttcttcgcg
cttgcgggaagcaaagccgacggctcggcctatgccgccgatgccgccaggcgcggtgcc
gtggcgatcgtaacagccaagggcagcaccgttggcgggcatccgattccagtgctggcg
gtcgacgatccgcgcctggcgctggcgctgggagccgcccgctttttcggcaaccagccg
caaaccatggtcgcggtgacaggcaccagcggcaagacgtcggtcgccgccttcacgagg
cagatctgggagcaggcgggctacgccgccgcctcgatcggcaccaccggcgtggtggcg
ccgggccgcaacgaatatggttctctgacgacgcccgatccggtcgccctgcaccagttg
ctcaaggaattggccgacgccggcgttacccacgcctcgatggaggcttccagccacggg
ctcgaccagcgccgcctcgacggcgtcaagctcgcggccggcggcttcaccaatcttggc
cgcgaccacatggattaccatccaacggtcgaggattatcaccgcgccaaactgcgcctg
ttcgacacgctgctgccgaagggcgcgccggcggtcatctttgccgacgatccgtggtcg
gcgccgacaatccaggccgcgcgggccgccgggctcgaggtgctgaccgtcggccgccat
ggcgatttccttaggctgaaacgggtcgagcatgagcgtcatcgccagcgcgccgaggtc
gaggccaacggtgtgctttatgaaatcgacctgccgctggccggcgatttccagatttcg
aacgcgcttgtgtccgcggggcttgccatttccacgggaataccaactgccaaggctttg
atgtcgttggagaaattgaagggcgcgccgggccggctcgacctcgtcgggaccaccgcc
aatggcgcgcccgtttatgtcgattatgcccacaagcccgatgcgctggaaaacgtgctg
acctcggtgcggccgttcaccacgggccgcgtcatggtcgtgttcggctgcggcggcgac
cgcgaccggggaaaaaggccgatcatgggcgagatcgcgacccggctcgccgatgtcgtc
atcgtcaccgacgacaatccgcgttcggaagtgcccgagacgatccgcgccgccatcatg
gctgcggcgcctggagccatcgagatcggcgaccggcgcaaggcgatccacgatgcggtc
gcgatgcttgatgccggcgacacgctgatcgtggccggcaagggtcatgaggagggccag
acgatcggctccgagacgctgcatttctccgatcatgaggaagtccgcgccgcgctgcgg
gagcgtgctgcatga

DBGET integrated database retrieval system