KEGG   Mesorhizobium opportunistum: Mesop_3910Help
Entry
Mesop_3910        CDS       T01542                                 

Definition
Aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mop  Mesorhizobium opportunistum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mop00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mop00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4013867..4014889
Genome map
AA seq 340 aa AA seqDB search
MAMKDGEVFGTTQAGEPVRRFTIRGGGLTANIIGLGAVIQDLRLTGHDAPLVLGYNTLEA
YEADNAFFGAVVGRYANRIRDGRFTIGGNRYQTEQNFLDKHTLHGGSQGYARRSWAVSLH
GRDFVTLTLHDPDGAMGFPGALDVTCTYRLKIPGTLSVELTATCEEPTLCNLTQHSYFNL
DDGGAGDVLDHRMMLNAGAYLPVDSDMIPTGVVKPVDGTPFDFHQARPLRMETEGEQLPY
DQNFCLGATRGPLRQASWTQGASSGVEMEVWTTEPGVQLYTGQYVTPRTGLEGRGYKAFS
GFCLEPQIWPDAPNRPYFPQATLWPGAIYHHVTEYRFRLP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaaagacggcgaggttttcggtacgacgcaggcgggcgagccggtgcgccgc
ttcacgatcaggggcggcggtctcaccgccaacatcatcggactcggtgccgtcatccag
gatttgcggctgaccgggcatgatgcaccgctggtgcttggctacaacaccctggaagcc
tatgaggccgacaacgcctttttcggcgcggttgtcggccgctacgccaaccgcatccgc
gatggccgcttcaccatcggcggcaaccgctaccagaccgagcagaatttcctcgacaag
cacacgctgcatggcggctcgcaaggttatgcgcgccgctcgtgggcggtttcgctgcat
ggcagggatttcgtcacgctgacgctgcatgatcccgacggcgcgatgggctttcccggc
gcgctcgatgttacctgcacctaccggctgaagatccccggcacgctcagcgtcgaactg
acggcgacctgcgaggagccgacattgtgcaatctcacccagcattcctacttcaaccta
gatgatggcggtgccggcgacgttctcgaccacaggatgatgctgaatgccggcgcctat
ctgcctgtcgacagcgacatgatcccaaccggcgtggtcaagccggtcgacggcacgccc
ttcgacttccaccaggcacgaccgctgcgcatggagaccgagggcgaacagctgccttat
gaccagaatttctgcctcggcgcgacgcgcgggccgctgcggcaagcatcatggacgcaa
ggggcgagttccggcgtcgaaatggaagtctggaccacggaaccaggcgtccagctttat
accggccagtatgtgacgccgcgcacgggcctggaagggcgcggctacaaggccttttcc
ggattctgccttgagccgcagatatggccggatgcgccgaaccggccgtatttcccgcaa
gcgacgctgtggccgggcgcgatctaccatcatgtgacggaataccggttcagactgcct
taa

DBGET integrated database retrieval system