KEGG   Mesorhizobium opportunistum: Mesop_3914Help
Entry
Mesop_3914        CDS       T01542                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mop  Mesorhizobium opportunistum
Brite
Enzymes [BR:mop01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Mesop_3914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4017158..4018357
Genome map
AA seq 399 aa AA seqDB search
MRRLSYFLALMVAVVLAGCGKPDFSDAEKKKIASLALNTLPPLKPDTTNRFADVPAAAAL
GSTLFFDLGMSRDGTVSCSTCHKIDGQFQDDLPQAVGVGRTNRRTMPLAGVARDPWFFWD
GRRDSLWAQALTPLENPLEQAGNRAAYAHYIKARFGERYERIFGPLPDFSGIPANASPLG
TDAEKAAWSAMSDTQRDAINRVFSNIGKAIAAFERSIEPAQTRFDRFALDLATGAEPKGD
AVFSREEILGLKLFIGKANCVTCHDGPRFTDNGFHNTGVPPVTGLPPDRGRVDAVTQVEA
DPFNCFGAYRDGGAGACGELRFMVKDAPQLVRAYKTPSLRGAATRPPYMHAGQFSSLDEV
VAHYAKAAPSVEGTSEIHPLELSDRERAALVAFLKTLSE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgcctttcttattttctggcgctgatggtggccgttgtcctcgcgggctgcggc
aagccagatttttccgacgctgagaagaagaagatcgcttcgctggcgctgaacacattg
ccgccactgaagcccgacacgacgaaccggtttgccgatgtgccggcggcagccgcgctc
ggctcgacgctgttcttcgatctcggcatgagccgcgacggcacggtctcatgctcgacc
tgccacaagatcgacggccagttccaggacgacctgccacaagccgtcggtgtcggccgc
accaaccggcgcaccatgccactggccggcgtggcgcgcgatccctggttcttctgggac
ggccgccgcgacagcctttgggcgcaagcgctgacgccgctcgaaaacccgctggagcaa
gcgggaaaccgcgccgcctacgcccattacatcaaggcgcgcttcggcgagcgctatgag
cgcatcttcgggcctttgcccgatttttccggcattccggcgaatgccagtccgcttggc
accgatgccgaaaaggccgcctggagcgcgatgagcgacacgcagcgcgacgcgatcaac
cgcgtcttttccaatatcggcaaagcgatcgccgcattcgagcggtcgatcgagccggca
cagacgcgcttcgatcgctttgcactggaccttgccacaggcgcagagccgaagggcgat
gccgtcttttcccgggaggaaatcctcgggctaaaactgttcatcggcaaggccaattgc
gtgacctgccacgacggcccgcgcttcaccgacaacggttttcacaacaccggcgtgccg
cccgtgacgggcctgccgccggatcgcggccgcgtcgacgcggtgacacaggtcgaggcg
gatccgttcaattgcttcggcgcctatcgcgacggcggtgccggcgcctgcggcgagctg
cgcttcatggtcaaggatgcgccgcaactggttcgcgcctacaagacgccctcgctgcgc
ggcgctgcaacgcggccgccctacatgcatgccgggcaattctcgtcgctcgacgaagtg
gtggcgcactatgccaaggccgcgcccagcgtcgaggggacatccgagattcacccgctg
gagctgtccgaccgtgaacgcgcggcgctggtggcgtttttgaagacgctgtcggaataa

DBGET integrated database retrieval system