KEGG   Mesorhizobium opportunistum: Mesop_3950Help
Entry
Mesop_3950        CDS       T01542                                 

Definition
glycoside hydrolase family 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mop  Mesorhizobium opportunistum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mop00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mop00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4057909..4059222
Genome map
AA seq 437 aa AA seqDB search
MFSINLVTGFFSALLMTSVAVAGPQAAQVKADAKTSDSKTADAKTAASRRLDDSSLRVMI
GQMILVGFNGVSADAASVVAVRQEIADGSIGGIMYLSDNVSDRTHVAAMNAAFLAANRKL
PPFISVDEEGGAIARLTADNGFHEVPAAVDVASKFSPRGAYELYSRLATDLREWGFNLNF
GPVADLNVNPANPIIGKLGRSFSANPEIVAQYGAAFVRAHRDAGVVTTLKHFPGHGSSST
DSHKGLADVSGTWSSQELIPFRKLINAGYADSVMVGHLYDRALQKGEAVGPASLSSAIVT
GLLRKDLGFEGVVFSDDLQMDAVENSYSFGGAVVRAVEAGDDILIFSNHKNPDADLPEKV
IDILMAEARRNPVVAANIVKSFAKISALKASLAQRGGPMIDLLSTKSITPDPGNEVTPAD
VEMVRRDMALKVVGLPG
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgttctccatcaacctggtaaccgggtttttttcggcgctgctgatgacttcggtggcc
gtcgcgggtccgcaggcggctcaggtgaaagccgatgccaagacgtccgactccaagacg
gccgatgccaagacggccgcttcgcgaaggctcgacgattcgagtctccgcgtgatgatt
ggccagatgatcctggtcggcttcaatggagtctcggccgacgcggcgtcggtggtcgcg
gtcaggcaagagatcgccgacggcagcatcggggggatcatgtatctttccgacaacgtc
agcgacagaacgcacgtggcggcgatgaacgcggcgtttctggccgccaatcggaagttg
ccgcccttcatttccgtcgatgaggagggaggggcaattgcaagattgacggctgacaac
ggatttcacgaggttccggccgccgtcgatgtcgccagcaagttctcgcctcgcggcgcg
tacgaactctactccaggctcgcgacggatttgcgtgaatggggcttcaacctcaatttc
ggtccggtggcggacctgaatgtgaatcccgccaatcccattatcgggaagttgggcagg
agcttttccgcgaacccggaaatcgtcgcccaatatggcgcggccttcgtaagggcacat
cgcgacgcgggtgtcgtaaccacgctcaagcattttcccgggcacggctcgagctcgacc
gatagccacaaggggctggcggacgtatccggcacctggtcgagccaggaactgattccg
tttcgcaaactgatcaatgcgggctacgcggactcggtcatggtgggccatctctacgac
cgcgccctgcaaaagggggaagccgtggggccagcctcgctctcatcggcgatcgttact
ggcctgctgcgcaaagaccttggcttcgaaggcgtcgtcttttcggacgacctgcaaatg
gacgccgtggaaaacagctattcgttcggtggcgcggttgtgcgcgccgtcgaggcggga
gacgatattctgatcttctcgaaccataagaacccggatgccgacctacccgaaaaggtc
atcgacatcctcatggctgaagcccgcaggaacccggtggtcgcggccaacatcgtgaag
tcgtttgccaagatatcggctctcaaggcaagtctcgcacagcggggtggtccaatgatc
gatctgctttcgaccaaatccatcacgcccgatccgggtaacgaggtcacgccggccgac
gtggagatggttcggcgcgacatggccttgaaggtcgttgggctgccgggctga

DBGET integrated database retrieval system