KEGG   Mesorhizobium opportunistum: Mesop_4120Help
Entry
Mesop_4120        CDS       T01542                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mop  Mesorhizobium opportunistum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4240676..4241746)
Genome map
AA seq 356 aa AA seqDB search
MQPAATQTERNTDIASTVVTTMRQLGVLGLPRNYEIFYEALSGTNRELSLAVVSLSSRPT
QDELDQIGRTFFAHNHGPGIVEHARDVIARELEEVASLLRSERSHIEKYGRILDETSSGL
SGRSLLSQDLLQKIASAMSVATSSTIDHGRQIASTLRDKTAELESVKSKLEEYKRLADTD
PLTHIWNRRAFDKEITRIYNSNKGILFNALILADIDRFKDINDRYGHPVGDKIIQIIAEI
FQTSIRGDMFVARTGGEEFALIIEGASEDATYDISERIRALIEQTPFTSSQTGANYGTVT
VSMGICMASEADGPEDLYTKADRALYRSKVSGRNRVTRHSTMAGRAGKSWLLYKKD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcagccggcagccacccagaccgaaagaaacaccgatatcgccagcaccgtcgtcacg
accatgcgccagcttggcgtgctcggcctgccgcgcaactacgagattttctacgaggca
ttgagcggcaccaaccgggagctcagtctcgccgtcgtgtcgctgagtagccggccgacg
caggatgagctggatcagatcgggcgcaccttctttgcccacaaccatggccccggcatc
gttgagcatgcgcgggacgtcatcgccagggagctcgaggaagtcgcatcactcctgcgg
agcgagcgcagccacatcgagaaatacggcaggatcctcgacgagacatcgagcggtctg
agcggccgcagcttgctgtcgcaggacctcttgcagaagatcgccagcgccatgtcggtc
gccaccagttcgacgattgatcatggcaggcagattgcatcgacactccgtgacaagacc
gccgaactcgagagcgtcaagtcgaagctcgaggagtacaagcggctggccgacaccgac
ccgttgacccatatctggaaccgccgcgccttcgacaaggaaatcaccaggatctacaac
agcaacaagggcatcctgttcaatgccctgatccttgccgatatcgatcggttcaaggac
atcaacgatcgctacggccatccggtcggcgacaagatcatccagatcatcgccgagatt
ttccagaccagcattcgcggcgacatgttcgtcgcccgcaccggcggcgaggagttcgcg
ctgatcatcgagggcgccagcgaggacgccacctacgatatctcggagcgcatccgtgcg
ctgatcgagcagacgccgttcaccagcagccagaccggcgccaattacggcaccgtcacc
gtctccatgggcatctgcatggcatccgaggccgatggccccgaagacctctataccaag
gccgaccgggcgctttaccggtccaaggtcagcgggcgcaaccgcgtcaccaggcattcg
acgatggccggccgcgccggcaagagctggctgctctacaagaaggactaa

DBGET integrated database retrieval system