KEGG   Mesorhizobium opportunistum: Mesop_4210Help
Entry
Mesop_4210        CDS       T01542                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mop  Mesorhizobium opportunistum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mesop_4210
Enzymes [BR:mop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mesop_4210
Exosome [BR:mop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mesop_4210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4334989..4336482
Genome map
AA seq 497 aa AA seqDB search
MSGFVLAIDQGTTSTRAIMFDGDMKVVGSGQKEFTQHYPASGWVEHDPEEIWSSVVATVK
AALKKAGRVASDVAAIGITNQRETVVIWDRATGKPIHNAIVWQDRRTAPLCHKLKKQGQE
KKFTRKTGLLLDPYFSGTKIAWMLDKVKGARRRAEKGELLAGTIDSFLIWRLTGGKVHAT
DATNASRTLVYNIAENVWDEELLSILRIPAAMLPEVKDCADDYGATEKGLFGAEIKIFGV
AGDQHAATIGQACFEPGMMKSTYGTGCFALLNTGSDLVRSKNRLLTTIAYRLNGRTTYAL
EGSIFIAGAAVQWLRDGIKVIGKAEQSGKLADEADPSQNVYLVPAFVGLGAPHWDAEARG
AIFGLTRNSGPAEFARAALESVAYQTRDLLDAMRKDWKGGAAKTVLRVDGGMVASDWTMQ
RLADILDAPVDRPTILETTALGAAWLAGSKAGVWPDAKKFAKSWALERRFQPDMDSSIRS
AKLAGWRDAVRRTLSVP
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagtggttttgtgctggcgatcgaccagggtacgacgtcgacccgggcgatcatgttc
gatggcgacatgaaagtcgtcggctccgggcagaaggaattcacccagcactatccggcc
tccggctgggtcgaacacgatccggaggaaatctggagcagtgtcgtggcgacggtgaaa
gccgcgctgaagaaggccggtcgcgtcgcttcggatgtcgcggccatcggcatcaccaac
cagcgcgagaccgtcgtcatctgggacagggcgacgggcaagccgatccacaatgcgatc
gtctggcaggatcgccgcaccgcaccgctctgccacaagctcaagaagcaagggcaggag
aagaaattcacccgcaagaccggcctgctgctcgatccttatttttcgggcaccaagatc
gcctggatgctcgacaaggtgaaaggggcgaggcgacgcgcggagaagggcgagttgctg
gccggcaccatcgatagtttcctgatctggcggctgaccggcggcaaggtccacgccacc
gatgccaccaatgcctcgcgcacgctggtctacaacatcgccgagaatgtctgggacgag
gaactgctttcgatcctgcgcatccccgccgcgatgctgcctgaggtgaaggattgcgcc
gacgattacggcgccaccgagaagggtctgttcggcgccgagataaagatcttcggcgtt
gccggcgaccagcatgccgcgaccatcggccaggcctgcttcgagccgggcatgatgaag
tcgacctatggcaccggctgcttcgcgctgctcaacaccggcagcgacctggtccgttcg
aagaaccggctgttgaccaccatagcctaccggctgaacggcaggacgacctatgcgctg
gaaggctcaatcttcattgccggtgcggccgtgcaatggctgcgtgacggcatcaaggtg
atcggcaaggccgagcagagcggcaaattggctgatgaggctgatccctcgcaaaacgtc
tatctggtgccggccttcgtcgggctcggcgcgccgcactgggacgccgaagcgcgcggc
gccatcttcgggctgacccgcaattccggtccggcggagtttgcgcgcgccgcacttgaa
tcggtcgcctatcagacgcgcgacctgctcgacgccatgcgcaaggactggaagggcggc
gcggccaagacggtgctcagggtcgatggcggcatggttgcatcggactggaccatgcag
cgcctggccgacatcctcgacgcacccgtcgaccgcccgaccattctggagaccacggcg
ctgggggcggcctggctcgccgggtcgaaggcgggcgtgtggccggatgccaagaagttt
gcgaaaagctgggcgctcgagcggcgcttccagccggatatggatagctccatacgctcg
gccaaactcgcaggctggcgcgatgctgtgcgcaggaccctgagcgtgccataa

DBGET integrated database retrieval system