KEGG   Mesorhizobium opportunistum: Mesop_4683Help
Entry
Mesop_4683        CDS       T01542                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00220  Arginine biosynthesis
mop00250  Alanine, aspartate and glutamate metabolism
mop00471  D-Glutamine and D-glutamate metabolism
mop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mesop_4683
   00220 Arginine biosynthesis
    Mesop_4683
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Mesop_4683
Enzymes [BR:mop01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Mesop_4683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Peptidase_S11 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AEH89104
UniProt: F7YEY6
Position
complement(4811077..4812042)
Genome map
AA seq 321 aa AA seqDB search
MPELEQAPKLDQAPKLDQALAEVAAEMAERTDRGDVATYIPQLGKVDPRKFGIAAVTNDG
RVLVAGDADQPFSIQSISKVFTLTLALGNVGDALWKRVGREPSGNPFNSIVQLEHENGIP
RNPFINAGAIVISDILLAGHQPREAIGEILRFIQFLADDETIIIDREVAASERATGYRNF
ALANYMKSFGNLHHAPELALGVYFHHCAIAMSCRQLAMAGRFLANGGKNPATGHSVVSAE
RARRIGAMMLTCGHYDGSGDFAFRVGIPGKSGVGGGILGIVPGVASLAVWSPGLNANGNS
KLGSIALEKLARMMNWSIFAP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactcgaacaggcccccaaacttgatcaggcccccaaacttgatcaggcattg
gccgaggtcgccgccgaaatggccgagcgcaccgatcgcggcgacgtcgcgacctacatt
ccccagctgggcaaggtcgatccgaggaaattcggcattgccgccgtcaccaatgacggc
cgcgtgctggtggcgggcgatgccgaccagccgttctcgatccagagcatctcgaaggtc
ttcaccttgaccctggcgctcggcaatgtcggcgatgcactgtggaagcgggtggggcgc
gagccgtccggcaatccgttcaactccatcgtacagctcgagcacgagaacggcattccg
cgcaatccgttcatcaatgccggcgccatcgtcatttccgacatcctgctcgccggccac
cagccgcgcgaggcgattggcgagatcctgcgtttcatacagttcctggccgacgacgag
accatcatcatcgaccgcgaggtggcggcctccgagcgcgccaccggctatcgcaacttt
gcgctcgccaactatatgaaatccttcggcaatctccatcatgcaccggagcttgcgcta
ggcgtttatttccatcactgcgccatcgccatgagttgccggcaactggcgatggccggc
cgcttcctcgccaatggcggcaagaacccggcgacggggcattccgtggtgtcggccgag
cgggcgcggcgcatcggcgccatgatgctgacctgcggccattatgacggctccggcgat
tttgccttccgcgtcggcattcccggcaagagcggcgtcggcggcggcatattgggcatc
gtgccgggtgtcgcctcgcttgccgtctggtcgcccggcctcaatgccaacggcaactcc
aagctcggttcgatcgcactggaaaagctggccaggatgatgaactggtcgatcttcgcg
ccttag

DBGET integrated database retrieval system