KEGG   Mesorhizobium opportunistum: Mesop_4859Help
Entry
Mesop_4859        CDS       T01542                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mop  Mesorhizobium opportunistum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mesop_4859
Enzymes [BR:mop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mesop_4859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4969652..4970596)
Genome map
AA seq 314 aa AA seqDB search
MASGKPVVMKPVVILGVFVADTAYRADRQPRMGETILGNSFKLGPGGKGSNQAVAAGKLG
ADVTFLSRLGVDPFADMAKQTWAQAGVKSAVIDTPDSYTGAAYIFVEEGSGNNAIIVSPG
AAMLISPADIEANADLIRAAGVFVTQLEQPIDAAMRALEIARGAGVTTILNPAPAAKLPD
RIYTLCDYLTPNETETEELTGMKVSSVGEARAAADRLLEKGVGTVIVTLGDKGALLHAKD
RSEHVPVVSAGPVVETTGAGDAFNGGFAAALSRGVEPLEAVRFACAVAGISVTRPGTAPS
MPTLQEVEALLAKG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgggcaagccggtcgtcatgaagcctgtggtcatattgggggtcttcgttgcc
gataccgcctatcgcgccgatcgccagccgcgcatgggcgaaacgattctcggcaattcg
ttcaagctcggacctggcggcaagggctccaaccaggcggtcgccgccggcaagctcggc
gccgacgtcacgtttctgagccgccttggcgttgaccccttcgccgacatggcgaagcag
acctgggcgcaggcgggtgtgaaaagcgccgtcatcgacacgccggacagctacacgggc
gccgcctacatcttcgtcgaggagggaagcggcaacaacgccatcatcgtcagcccgggc
gccgccatgctgatctcgccggcggatatcgaggccaacgcggatctgatccgcgccgcc
ggcgtcttcgtcacacagctcgaacagccgatcgatgcggcgatgcgggcattggagatc
gcgcgcggggcaggggtgacgaccatcctcaacccggctccggcggcaaagcttcccgat
cgcatctacacgctctgcgactatctcacgcccaatgaaaccgagacggaggaattgacc
ggcatgaaggtctcttcggtcggcgaagcacgggccgccgcggacagactgctcgaaaag
ggcgtcggcacggtcatcgtcacgctcggcgacaagggcgcgcttctgcacgcgaaggat
cgctcggagcatgttcccgtcgtcagcgcgggcccggtggttgaaaccaccggagcaggg
gatgccttcaacggcggcttcgccgcggccctgtcgcgaggcgtggagccgctggaggct
gtgcgcttcgcctgcgccgtcgccggtatttccgtgacccgtccaggcacggcgccatcg
atgccgacgctgcaggaggtcgaggcgctgctggcgaagggttga

DBGET integrated database retrieval system