KEGG   Mesorhizobium opportunistum: Mesop_4888Help
Entry
Mesop_4888        CDS       T01542                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mop  Mesorhizobium opportunistum
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mop00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4998875..4999882
Genome map
AA seq 335 aa AA seqDB search
MATKTIDHAFTARSKTGAAFEPTYSGALSFMRRKYTKDVKGADAVVWGIPFDAAVTNRPG
ARFGPQAIRRASAILDNDPQYPFSRDLFEHLAVVDYGDCLLDSGNHQKTPGTIEREAAKI
LKSGAFLLTLGGDHFVTWPLLKAHAAIHGPLALVQFDAHQDTWEDDGKRIDHGSFVGRAV
KEGIIDPDRSIQIGIRTHAPDTFGIKILHGHEIEEMRASDIAYAIVDRTGGKKTYLTFDI
DCLDPAYAPGTGTPVAGGPSSAKILSTLRQLNQVDIVGADVVEVAPAYDHADITAIAGSM
VAMQYLGLLAERKARLEELNNGNHNGAVVNHGNGI
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaagaccatcgaccatgccttcaccgcccgctccaaaacgggcgctgcgttc
gagccgacctattccggcgcgctgtcgttcatgcggcgcaaatatacgaaggacgtgaag
ggcgcggacgcggtcgtgtggggcattccgttcgatgccgccgtcaccaaccggccaggc
gcgcgtttcggcccgcaggctatccgccgtgcctcggcgatcctcgacaacgacccgcaa
taccccttttcgcgcgacctgttcgagcacctcgcggtggtcgattatggcgattgcctg
ctcgactcgggcaaccaccagaagacgccgggcacgatcgagcgcgaggcggccaagatc
ctgaagtcgggcgccttcctgctgacgcttggcggcgaccatttcgtcacctggccgctg
ctcaaggcgcatgccgcaatccacggaccgctcgccctggtgcagttcgacgcgcatcag
gacacgtgggaggacgacggtaagcgcatcgaccacggttccttcgtcggccgcgcggtc
aaggaaggcatcatcgatcccgaccggtcgatccagatcggcatccgcacccatgccccc
gacacgttcggcatcaagattctccatggccacgaaatcgaggagatgcgcgcgtccgac
atcgcctacgccatcgtcgaccgcaccggcggcaagaagacgtatctgacgttcgacatc
gactgcctcgatccggcctatgcgcccggcacgggcacaccggttgccggcgggccgtcc
tcggcgaagatcctgtcgacgctgcggcagctcaaccaggtcgatattgtcggcgctgat
gtcgtggaggttgcgccggcctatgatcacgccgatataacggcgattgccggctcgatg
gtggccatgcagtatctcggcctgctggcggagcgaaaggcccggctcgaagagctgaac
aacggcaaccacaacggtgccgtggtgaatcatggtaacggcatatag

DBGET integrated database retrieval system