KEGG   Mesorhizobium opportunistum: Mesop_4941Help
Entry
Mesop_4941        CDS       T01542                                 

Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mop  Mesorhizobium opportunistum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mesop_4941
Enzymes [BR:mop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mesop_4941
Exosome [BR:mop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mesop_4941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5049809..5050840
Genome map
AA seq 343 aa AA seqDB search
MNRFTPTKPAGARSVDDVTGSRRLRRMRKADWSRRLVQENRLTVDDLIWPIFVVEGKNVR
EPIAAMPGVFRLSIDLAIKEAERAARLGIPALATFPNVDLALRDQTGSHILDPDNVINRA
TRAIKDAVPEIGIITDAALDPFTSHGHDGILRDGIIVNDETVEQVAAAAVIQAAAGADII
APSDMMDGRIGAIRDALDANGFQDVAIMSYATKFASAFYGPYREAVGTAGLLKGDKKTYY
IDHANSDEAVREAEQDIAEGTDMLMVKPGLPYLDIIRRLKDEFQMPTFAYQVSGEYSMIK
AAGANGWIDGEKAMLESLLAFKRAGCDGILTYFAPEVATMLKG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaacagattcaccccgacaaagccagccggcgctcgaagcgtcgacgatgtcaccggc
agccgccgcctgcgccgcatgcgcaaggccgactggtcgcgccggctcgtgcaggagaac
cggcttacggtcgacgacctgatctggccgatcttcgtcgtcgagggcaaaaatgtgcgc
gagccgattgccgccatgccgggcgtcttccgcctgtcgatcgaccttgcaatcaaggag
gctgagcgcgcggccaggctcggcattcccgcgctcgccaccttccccaatgtcgatctg
gccttgcgcgaccagaccggctcgcacatcctcgaccccgacaatgtcatcaaccgcgcc
acccgtgccataaaggacgcggtgcccgagatcggcatcatcaccgacgccgcgctcgac
ccgttcaccagccacggccatgacggcatcctgcgcgacggcatcatcgtcaacgacgag
acggtcgaacaggtcgcggcggcggccgtcatccaggcggcggccggcgccgacatcatc
gcgccgtccgacatgatggacgggcgtatcggcgccatccgcgacgcgctcgacgccaac
ggctttcaggacgtggcgatcatgtcctacgcgaccaaattcgcctcggccttctacggc
ccctatcgcgaggcggtcggcaccgccggcctgctcaagggcgacaagaagacctactat
atcgatcatgccaactcggacgaagccgtgcgcgaggccgaacaggacatcgccgagggg
accgacatgctgatggtcaagcccggcctgccctatctcgacatcatccgcaggctgaag
gacgaattccagatgccgaccttcgcctaccaggtgtcgggcgaatattcgatgatcaag
gcggcgggcgccaatggctggatcgacggcgagaaagcgatgctggagagcctgcttgcc
ttcaagcgcgccggctgcgacggtatcctgacctatttcgcgccagaggtggcgacgatg
ctgaaggggtag

DBGET integrated database retrieval system