KEGG   Mesorhizobium opportunistum: Mesop_5398Help
Entry
Mesop_5398        CDS       T01542                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mop  Mesorhizobium opportunistum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mesop_5398
Enzymes [BR:mop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mesop_5398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5508100..5509011
Genome map
AA seq 303 aa AA seqDB search
MRVHVVGNVCVDTTFRLDRFPRPGETLNASEHADGLGGKGANQAVAAARTGADVRFWTAI
GNDAAGAWIREQLRRDLDTSHLTMLPKESDRSTIIVDARGENLIVTGASCATAFDPLAES
GFAASIERGDIVVMQGNLHPDATTACLRTAHEAGAVTIFNPSPLATGATPHLSDISLAIA
NAGEAAQLTGKGDPDAAARELIRRGAGTAIVTLGALGCLVADGEGRIERIMAPKVAVTDT
SGAGDVFCGCLAGCLAAGMDLAAAARIAVRAAAISVGRAGTLGSCPDRQEMKTLMETTEA
ETA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtccatgtcgtcggcaatgtctgcgtcgatacgacgtttcgactggaccggttc
ccgcggccgggcgagacgctgaacgcatcggaacacgccgacggacttggcggcaagggc
gcgaaccaggcggtagccgccgcgcgcaccggagccgacgtccggttctggacggcgatc
ggcaatgatgccgccggggcttggataagggaacaattgcgccgcgacctcgacaccagc
catctgacgatgctgcccaaggagagcgaccgttcgacgatcatagtcgatgcgcggggc
gagaacctcatcgtcaccggtgccagttgcgccactgccttcgatcccctggcagagagt
ggattcgcggcctcgatcgaacgcggcgacatcgtcgtgatgcagggcaatctccatccg
gatgcaacgacagcctgcctgcggacggcgcatgaagcgggcgccgtgaccatcttcaat
ccaagcccgcttgcaactggtgcgacgccgcatttgagcgatatcagcctcgccatcgcc
aatgcgggcgaagcggcgcaactgaccggaaaaggcgatcctgacgcggcagcccgcgag
ctgatccgtcgaggcgcaggcaccgctatcgtgacgcttggcgcgcttggctgcctcgtc
gccgatggtgaaggacggatcgagcggatcatggcgcccaaggtggctgtgacggacacc
agcggcgcgggtgacgtgttttgcggttgcctcgccggctgccttgccgccggcatggat
ctcgctgcagcggccaggattgcggttcgcgctgcggccatctcggtcggacgcgccgga
acgctcggctcctgccccgacaggcaggagatgaaaacgctcatggaaacgacggaagcg
gaaaccgcatga

DBGET integrated database retrieval system