KEGG   Mesorhizobium opportunistum: Mesop_5590Help
Entry
Mesop_5590        CDS       T01542                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mop  Mesorhizobium opportunistum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesop_5590
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesop_5590
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mesop_5590
Enzymes [BR:mop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mesop_5590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5725182..5726579
Genome map
AA seq 465 aa AA seqDB search
MQYVSTRGEAPALGFSDAVLAGLARDGGLYVPREWPQFSPSEIRAMRGLAYPDLAIRVLS
PFLGGEIAAPVFERLVREAYATFRHEAVCPLVQIAPNTFVLELFHGPTLAFKDVAMQLLA
RLMDHVLAERDQHATIVGATSGDTGGAAIDAFAGRSRTDIFILFPHGRVSPVQQRQMTTS
TAQNVHALAIEGNFDDCQGLLKDMFNDHGFRDRVALSGVNSINWARIMAQIVYYFSSALS
LGAPDRPVSFTVPTGNFGDIFAGYAAKRMGLPIERLVIATNDNDILARTFETGEYRTKGV
FATTSPSMDIQVSSNFERLLFEASGRNASTVRRYMAGLKQSGAFTIETPEITEMRTEFDA
GRADMDQVAATIRSTLAASNYLLDPHTAAAVHVAAGKPAGAVPMVVLGTAHPAKFPAAVK
AASGIHPALPAWLGGLMKTEEKYTVLPSDLKMVEDYVSRRARAAR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatgtgagtacccgtggggaagcgcccgcgcttggattttccgacgccgtgctg
gcgggcctggcgcgtgatggtgggctctatgtgccgcgcgagtggccgcagttttcgccg
tccgagatccgcgccatgcgcggccttgcctatcccgaccttgcgatccgcgtgctgtcg
cccttccttggcggcgaaatcgccgcacccgtcttcgagcgcctggtgcgtgaagcctat
gccaccttccgccacgaggccgtctgcccgctggtgcagatcgctcccaacaccttcgtc
ctcgaactcttccatggcccgacgctggctttcaaggacgtggcgatgcagttgctcgcc
cggctgatggaccatgtgctcgccgagcgcgaccagcatgccaccatcgtcggcgccacg
tcgggcgataccggcggagcggccatcgacgcttttgccgggcgcagccgcaccgacatc
ttcatcctcttcccgcatggccgcgtgtcgcccgtgcagcagcggcagatgacgacatcg
accgcccagaacgtgcatgcgctggcgatcgaaggcaatttcgacgattgccagggcctg
ctcaaggacatgttcaacgatcacggctttcgcgaccgggtggcgctttcaggggtcaac
tcgatcaactgggcccgcataatggcccagatcgtctattatttctcctcggccttgtcg
ctcggcgcgccggacaggcccgtatccttcaccgtgccgaccggcaatttcggcgatatc
ttcgccggctacgcggccaagaggatgggcctgccgatcgagcggctggtcatcgccacc
aacgacaacgacatattggcgcgcaccttcgagaccggcgaataccgcacaaagggcgtc
ttcgcgaccacctcgccgtcgatggacatccaggtgtcatcgaatttcgagcgcctgctg
ttcgaggcctccggccgcaatgcctcgaccgtgcggcgctacatggccgggctcaagcag
tcgggtgctttcaccatagaaaccccggaaatcactgagatgcggaccgaattcgacgcc
ggccgtgccgatatggaccaggtcgctgccaccatccgctcgacgcttgcggcgagcaat
tacctgctcgatccgcatacggcggcagcggtccacgtcgccgcaggcaagcccgccggt
gccgtgccgatggtggtgctgggtacggctcatccggcaaagtttccagccgcggtcaag
gccgccagcggtatccaccccgccctgcccgcatggctaggcgggttgatgaaaacggag
gaaaaatacacggtacttccatccgacctgaaaatggtggaagattacgtcagccgccgc
gcgcgagcggcgcgttag

DBGET integrated database retrieval system