KEGG   Mesorhizobium opportunistum: Mesop_5784Help
Entry
Mesop_5784        CDS       T01542                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mop  Mesorhizobium opportunistum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:mop01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mop01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mop00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mop00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mop00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:mop00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5923830..5924588)
Genome map
AA seq 252 aa AA seqDB search
MVYWVGTSWKMNKTLAEAMDFAAILAGFVPGFDDRIQPFVIPPFTAVRQVKQALSSTRVK
VGAQNMHWADAGAWTGEISPVMLTDCGLDLVELGHSERREHFGETDRTVGLKTAAAVKHG
LIPLICVGETLAERESGEADAVLAKQVEGALQFFEEEVKGATILFAYEPVWAIGDKGIPA
SSDYADKQQGLIKAVAGSLLPSVPSVLYGGSVNPGNAAELIGQPNVDGLFIGRSAWQAQG
YIDILGRASAAI
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtggtttactgggtcggtacaagctggaagatgaacaagacgctcgccgaggcgatggat
ttcgccgcgatcctggccgggttcgtccctggtttcgacgatcgcatccaacccttcgtc
atcccgcccttcacggcggtgcgtcaggtcaagcaggcgctgtcctcgacgcgggtcaag
gtcggcgcccagaacatgcattgggccgatgccggcgcctggaccggcgagatttcaccc
gtgatgttgaccgattgcgggctcgatctggtcgaactcggccacagcgaacggcgcgag
catttcggcgagaccgatcgcaccgtcggcctgaagacggcggcggccgtgaagcacgga
ttgataccgctgatctgcgtcggcgagacgctggccgagcgcgaaagcggcgaggccgat
gccgtgctggccaagcaggtcgagggtgcgctgcaattcttcgaagaggaagtgaagggc
gcaacaatcctgttcgcctacgagccggtctgggcgatcggggacaagggcattccggcc
agttccgactatgccgacaaacagcagggactgatcaaggccgtggccggtagcctgctg
ccgtccgtcccgtcggtgctctatggcggcagcgtcaaccccggcaatgccgccgaactg
atcggtcagcccaatgtcgacggtctcttcatcggccgctccgcctggcaggcgcaaggc
tacatcgacatcctcggccgcgcctcggccgcgatctga

DBGET integrated database retrieval system