KEGG   Mesorhizobium opportunistum: Mesop_5822Help
Entry
Mesop_5822        CDS       T01542                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00010  Glycolysis / Gluconeogenesis
mop00052  Galactose metabolism
mop00500  Starch and sucrose metabolism
mop00520  Amino sugar and nucleotide sugar metabolism
mop00521  Streptomycin biosynthesis
mop01100  Metabolic pathways
mop01110  Biosynthesis of secondary metabolites
mop01120  Microbial metabolism in diverse environments
mop01130  Biosynthesis of antibiotics
mop01200  Carbon metabolism
Module
mop_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesop_5822
   00052 Galactose metabolism
    Mesop_5822
   00500 Starch and sucrose metabolism
    Mesop_5822
   00520 Amino sugar and nucleotide sugar metabolism
    Mesop_5822
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mesop_5822
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Mesop_5822
Enzymes [BR:mop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mesop_5822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N DUF4445
Motif
Other DBs
NCBI-ProteinID: AEH90230
UniProt: F7YF43
Position
complement(5967648..5968667)
Genome map
AA seq 339 aa AA seqDB search
MSSEAALAIDLGGTELRAALVDRDGKILAFSAVPTQAQAGPDVVIGQIEALAATVHAEAP
GLAIVGVGVGAPGPLDPLAGIAVGPPTLAGWQDVPLADILERRLGLPVRLENDANAAALG
EWRFGAGHGARSLVFVTVSTGIGGGVVVDGRILHGRRGLAAEIGHMTITNEGERCVCGVV
GCFEAIASGTALGRRADAATAPWDGSTLRRLSANAEVTGRHVVEAARLQDDLAVALLEEE
ARWLGVGFTNLLHLYSPDVLVVGGGIANGLDLMAPVIEATIRQRAMRAYRDVPVVEAQLG
RHAGLVGAASLVLFDDGSLAARMPVGPSTFPDIRRDFKG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgaagccgctctcgcgatcgatcttggtggcaccgagcttcgtgccgcgctg
gtcgaccgtgacggcaagatcctggccttttcggccgtgccgacgcaggcgcaggccggc
cccgatgtggtgatcggccagatcgaggcgctggccgcgaccgttcatgccgaggcccct
gggctcgccattgtcggtgtcggcgtcggtgcgcccgggccgctcgatccgctggccggc
atcgcggtcgggccgccgacactcgccggctggcaggacgtgccgctggccgacatcctc
gagcgccggctcggcctgccggtgcggctggagaacgacgctaacgcggcagcgctcggc
gaatggcgcttcggcgccggccacggcgcgcgttcgctggtgttcgtcacggtgtcgacc
ggcatcggtggcggcgtcgtggtcgacgggcgcatcctgcacggccgccgcggtcttgcg
gccgagatcggccacatgaccatcaccaatgagggcgaacgctgcgtctgcggtgttgtc
ggctgcttcgaggctatcgcctcgggaaccgcgctcggccgccgcgccgacgccgcgacg
gctccctgggacggctcgacgctgcgccgcctctcggccaacgccgaggtgacgggccgc
cacgtggtcgaggccgcgcggctgcaggatgacctcgctgtggccttgctcgaggaggag
gcgcgctggctcggcgtcggcttcaccaatctcctgcatctctattcgcccgacgtgctg
gttgtaggcggcggcatcgccaacggcctcgacctgatggcgcccgtcatcgaagcgacc
atccggcagcgcgccatgcgcgcctaccgtgacgtgccggttgtcgaggcccagctcggc
cgccacgccgggctggttggcgcggccagccttgtcctgttcgatgatggcagcctggcg
gcgcgcatgcctgtcggtccaagcacctttccggacatcaggagggacttcaagggctga

DBGET integrated database retrieval system