KEGG   Mesorhizobium opportunistum: Mesop_6566Help
Entry
Mesop_6566        CDS       T01542                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mop  Mesorhizobium opportunistum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mop00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mesop_6566
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mesop_6566
Enzymes [BR:mop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mesop_6566
Two-component system [BR:mop02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mesop_6566
Bacterial motility proteins [BR:mop02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mesop_6566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6755545..6756645)
Genome map
AA seq 366 aa AA seqDB search
MVDIRNRISPARANRTSSPQEQARNRFIIVIGASAGGIEPLKKIVSDLPAELPAAVFIVL
HVGQISYLPAILDRVATLKTSVAENGASFRTGNIYVAPPGFHLLLHGDHMMLRRGPRENL
ARPAIDPLFRSAALSYGASVIGVLLSGALSDGTAGLRAVKAVGGIAAVQHPKDALVPSMV
ESALQYVEVDHCVPAAELARLLAKLAAEPADSTLPAPPMVRLEAAIAAQEHSTMKEADRL
GELSVFTCPECNGPLWELEDGDMLRYRCHTGHAFTAEAVLEAQAIEADEILWSLLRSHQQ
RAEFARRMAERERTRHRSQLAKELGQRAKEYDADAALVERILESRRVRVTGNGTVDQEGN
GKKREG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatattcgaaaccgcatttcacctgctcgcgcgaaccggacaagctcgccgcaa
gaacaggcgcgcaaccgcttcattattgtcatcggcgcgtcggcgggcggaatcgaaccg
ctgaagaagatcgtgagcgatctgcccgcggagctgccggcagccgtgttcatcgtgctc
catgtcggccagatcagctatctgcccgcaatcctcgaccgcgtcgccacgctcaaaacc
tcggtcgccgagaacggcgcgtccttcaggaccggcaacatctatgtggcgccgcccggc
ttccatcttctcctgcatggcgaccacatgatgctgcggcgcggaccgcgcgaaaacctc
gcccggccggccatagatccgctgttccgctcggcggcgctcagctacggcgcgagcgtc
atcggcgtcctgctctcgggtgcgctttccgacggcaccgccggcttgagagccgtcaag
gcggtcggcgggatcgcggccgtgcagcacccgaaggacgcgctggtgccatccatggtg
gaaagcgcgctgcaatatgtcgaggtcgaccattgcgtgccggcggccgagctcgctcgc
ctgctggctaagctggcggccgagccggctgacagcaccttgcctgccccgccaatggtc
agactggaggcggccatcgccgcgcaggagcattcgaccatgaaagaagcagatcgactt
ggcgaattgtcggtgtttacatgcccagaatgcaacgggccgctgtgggagctcgaagac
ggtgacatgctgcgctaccggtgtcataccggacacgcttttactgccgaggcggtattg
gaagcgcaggcgatcgaggcggatgaaattctatggagcctgctgcggtcacatcagcaa
cgggcggaatttgcccggcgcatggccgagcgggaaagaacacggcatcgctcgcagctc
gcgaaagagcttggccagcgggcaaaagaatacgatgcggatgccgctctcgtcgagcgc
atcctcgaaagcaggcgggttcgggtaacgggcaatggaacagtcgaccaggaaggcaac
ggcaagaaacgcgaaggctag

DBGET integrated database retrieval system