KEGG   Mesorhizobium opportunistum: Mesop_6590Help
Entry
Mesop_6590        CDS       T01542                                 

Definition
periplasmic binding protein
Orthology
K02016  
iron complex transport system substrate-binding protein
Organism
mop  Mesorhizobium opportunistum
Pathway
ABC transporters
Module
Iron complex transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:mop02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6774621..6775496)
Genome map
AA seq 291 aa AA seqDB search
MTRRGALALFVLPLVATMVRPADAKPLRVVCLDDGLAETLLMLGVTPVAVADREVWEKWV
VEPPLPPQVADIGTILEPNLEFLQQLRPDVILSIPYLDGIKPLLERVAPVTTIGIYTPDG
QPYQRAIEATRQLAALVGRESEGEALIAATEAHFSDVRQRLAPLSARPIYVVSFLDPRNV
RVYGEKSLFQAVFDRIGIRNAWTGETNYWGFATVGIDGLATSDDARLAYLEPLPEGAGGT
LTESQVWNAMPFVRNRSIMRLAPVLMFGTLPSASRFARLLAQALTTEPAGG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgactcggcgcggcgcgctggcgctgttcgtgctgcctttggtcgcaaccatggttcgg
ccggctgacgcgaagccgctgcgcgtcgtctgcctggacgatgggctggcggagactttg
ctgatgctcggcgtcacgccggtcgccgtcgccgaccgcgaggtctgggaaaaatgggtg
gtcgagccgccgctgccgccgcaggttgccgatatcggcacgatcctggagcccaatctc
gaattcctccagcagcttcgtcccgacgtcattctctccatcccctatctcgacggcatc
aaaccgctgctcgaacgcgtggcgccggtgacgacgatcggcatctatacgccggatggc
cagccctaccagcgcgccatcgaggcgacccgacagttggcggcgcttgtcggcagggaa
agcgaaggcgaagccctgatcgccgcaacggaggcgcatttttctgatgtcaggcagcgg
ctggcgccgctgtcggcgaggccgatctatgtcgtcagcttcctcgacccgcgcaatgtg
cgtgtctacggcgagaaaagcctgttccaggcggtgttcgaccgcatcggcatccgcaac
gcctggaccggcgagaccaattactggggatttgcaaccgtcggcatcgacgggctggcg
acatcggatgatgcgcgccttgcctatctcgaacccttgccggagggggcgggcggcacg
ctgaccgaaagccaggtctggaacgccatgcccttcgtgcgcaaccgctcgatcatgcgt
cttgcccccgttctgatgttcggcacgctgccttcggcgagccgttttgcccggctgctg
gcgcaagcgctgacgacggagcccgccggtggctga

DBGET integrated database retrieval system