KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0178Help
Entry
DAMO_0178         CDS       T02155                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mox00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(156772..157947)
Genome map
AA seq 391 aa AA seqDB search
MTSGMWIIRVVGVISVLVVTCTASAYGPRSEIDPVVDLIVKAWSGYSKRFILQDGRVQRP
RNSGDTVSEGQAYALLIASLLDDRKTFDKVLDWTEAHLSRKGRTGDHLLAWHWEPGKGVT
DWNSASDADLDYALALITASTRWRDERYARKARLVMNDLLDLETEMINGRRYLLPGSWRK
GRDAYMINPSYLSPAHFRIFFACTGDPRWNDLIEGSYHLIETASKRFAGTTGVGLVPDWL
LLTADGVLTHATGFSDRFSWDAIRTPWRLGMDALWFGEDRARRYLDGMRDFYTQEWERRG
GRFFAEYTYDGRPAGQYEHVAAYAMSLSALARSNGPVLTGVLGKLRNAFNKDAHLFEDSN
DYYANSLVLLALIFYREGRLPTLDPRNVVCR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcggcatgtggatcatcagggtagtcggggtcataagcgtactcgtggtcacc
tgtacggcgtcggcctacggtccaaggagtgagatcgatccggtggtcgatctgatcgtc
aaggcctggagcgggtacagcaagcggttcatcctccaggatgggcgcgtccagcgccct
cggaacagcggggatacggtctccgaaggacaggcgtacgcgctcctcatcgcgtcgctg
ctcgacgaccgaaagacattcgacaaggtcctggactggaccgaagcgcacctctcgcgg
aagggtcgcaccggcgaccatctgcttgcctggcattgggaaccaggtaagggggtcact
gactggaacagcgcgtccgatgccgacctcgattatgccctcgcgctgattaccgcctcc
acacgctggcgcgatgaacgctatgcccggaaggcgcgattggtcatgaacgacctgctc
gacctggaaacagagatgatcaacgggcggaggtatctcctgccggggagctggagaaaa
gggcgcgacgcctacatgatcaacccctcctatctgtcgccggctcacttccggatattc
tttgcatgtaccggagacccacgttggaacgacctgatcgagggaagctatcacctcatc
gagacggcttcgaagcgcttcgccgggaccacaggcgtgggcttggtgccggattggctg
cttctcacagcggacggagtcctgacgcacgccacgggattttcggatcggtttagctgg
gatgctattcgaaccccgtggcgactcggaatggatgcgctgtggttcggggaggatcgg
gctaggcgctaccttgatggtatgagggatttctacacacaggagtgggagaggcgcggc
ggtcgattctttgccgagtacacgtatgatggcagaccggccgggcaatacgaacacgta
gccgcttatgccatgagcctgtcggcattggcgaggtcgaacggccctgtcctgaccggc
gttctcgggaagctacgcaacgccttcaataaggacgcgcacctcttcgaagacagcaat
gactactacgcgaacagtctcgtactgcttgcgctgatcttctatcgcgaggggagactg
ccgacccttgatcccaggaatgtcgtttgccgatga

DBGET integrated database retrieval system