KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0331Help
Entry
DAMO_0331         CDS       T02155                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mox01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mox00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
307046..308197
Genome map
AA seq 383 aa AA seqDB search
MSREERSSPDARAAAREARRLVVKVGSAVLSKGDSALHQATLERIARELVWLRKKGCQVV
LVSSGAILAGMDRLGLTERPGSIPLKQAAAAVGQSLLMRRYEEIFAPYGQKLGQLLLTQD
DFRSRHRYLNARNTLFTLLHLGVLPVINENDTVAVDEIRFGDNDHLSALVATLLGADLLV
ILTDLDGLYTADPRKDPDARLVREVPRRSASLHFWADESGTGLGTGGMVTKVKAARAAAA
AGVPTIIANGLVEGNLERIVHGEAVGTLFQASASRMRGRKRWLAFATARRGRITVDAGAR
EALIRNGKSLLPSGVVSVDGGFEGGEVVSLCDIDGAEFARGVANYDAEQMERIKGIRTDQ
IEDVLGAKPFDEVVHRDNLVILV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcgaagaaagatcctcaccggatgctcgggccgccgcgcgtgaggcaagacga
ctggttgtgaaggtcggttctgccgtcctgtccaagggcgatagcgccttgcaccaggcc
acgttggagcggatcgcccgtgagctcgtctggctcaggaagaaaggatgccaggtcgtt
ctggtctcctccggcgccattctggcagggatggatcggcttgggctgaccgagcggcca
ggaagcatcccattgaaacaagctgctgccgctgtcggccagagcctgctcatgcgtcgt
tatgaggagatcttcgcgccgtatggccagaaactgggacagttgttgctgacccaggac
gactttcgttcgcgacaccggtaccttaatgcgcgcaatacattattcacgctgctccat
ctgggcgtgcttccggttatcaacgagaacgatacggtggccgtggacgagatcaggttt
ggggataatgatcatctttcggcgttggtggcgacgctgctcggggcggacctgcttgtc
attctgaccgatctggacgggctgtatacggctgatccgcggaaagatcctgacgcgagg
ctcgtccgtgaggtgcccagacggtctgcgtcgctccacttctgggccgacgagtcgggg
accgggctcggaacgggtgggatggtcacaaaggtgaaagcggctcgcgcggcggcggct
gccggcgtccctaccatcattgcgaacgggcttgtggaggggaacctggagcggattgtc
catggcgaggcggtcggcactctttttcaggcgtcagcgtccaggatgcggggccgcaag
cgttggttggcgtttgcgacagcgcgtcggggacggattactgtggatgccggggccagg
gaggcgctgatccgtaacggcaagagccttttaccctccggggtcgtctcggtcgatggc
ggatttgaggggggcgaggtggtgagcctctgtgacatcgacggcgcagagttcgcgagg
ggcgtggcaaactatgacgccgaacagatggaacggatcaagggtatcagaaccgaccag
atcgaggatgtgcttggcgccaagccgttcgatgaagtagtgcatcgggacaaccttgtg
atactggtataa

DBGET integrated database retrieval system