KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0342Help
Entry
DAMO_0342         CDS       T02155                                 

Gene name
tpiA
Definition
triosephosphate isomerase (TIM) (Triose-phosphate isomerase) (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DAMO_0342 (tpiA)
   01230 Biosynthesis of amino acids
    DAMO_0342 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DAMO_0342 (tpiA)
   00051 Fructose and mannose metabolism
    DAMO_0342 (tpiA)
   00562 Inositol phosphate metabolism
    DAMO_0342 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DAMO_0342 (tpiA)
Enzymes [BR:mox01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DAMO_0342 (tpiA)
Exosome [BR:mox04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DAMO_0342 (tpiA)
  Exosomal proteins of bladder cancer cells
   DAMO_0342 (tpiA)
  Exosomal proteins of melanoma cells
   DAMO_0342 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
315255..316013
Genome map
AA seq 252 aa AA seqDB search
MRIPVIAGNWKMYKTPSEAIVLAEGVVRALSSLNGPELVVCPPFTALAAVGQVVAGSRIG
LGGQDLHWAKEGAYTGEVSADMLRDIGCRYVIIGHSERRQYFGETDECVNKKSRAALASN
LIPIVCVGETLTEREAGRADAVVETQLKGALSGLVPEQVRRLILAYEPVWAIGTGKTATP
SQAEEMHAYIRKTIAMLFDAEMAYGIRILYGGSVKPDNAKELLERAEIDGALIGGASLQP
ESFAAIAAAANK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcccagtcattgccggtaactggaagatgtacaaaactccttccgaggccatc
gtactggcggagggagtggtaagagctttgtcgtcgctcaatgggccggagttggtagtg
tgtcctccattcacggcgcttgctgccgttggtcaggtcgttgccggatctcgaataggc
cttggcggtcaggacctgcattgggcaaaggagggggcctacaccggagaggtgtcggct
gacatgctcagggatatcggatgccgctatgtcatcatcggccactccgagcggcggcag
tacttcggagagaccgatgagtgtgtgaataagaagagtcgggcggccttggcgagcaac
ctgatcccgatcgtctgtgtcggcgagaccctcaccgagcgagaggcgggacgcgccgat
gctgttgtagagactcagctcaaaggggcgctgtcgggtcttgtgcccgagcaggttcga
cggcttatcctcgcgtatgagccggtctgggctatcggtacaggaaaaacggccaccccg
agccaggccgaggagatgcacgcatatatccgcaagaccatcgctatgctgttcgatgcc
gagatggcttacggtatccgcatcctctacggaggaagcgtcaagccggataatgccaag
gagctgctggagcgagctgagatcgacggtgcactgattggcggggcaagcctgcagccc
gagtcatttgcagcgatcgcagcagccgcaaataaatag

DBGET integrated database retrieval system