KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0393Help
Entry
DAMO_0393         CDS       T02155                                 

Definition
Helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mox00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DAMO_0393
Enzymes [BR:mox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DAMO_0393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(344238..346493)
Genome map
AA seq 751 aa AA seqDB search
MPARSYDTLQGTLERITYVNEENHYVVARLQVSGRRDLATIVGNLPTVTPGETLKLTGEW
IQHNRYGEQFKVEAFETISPATLTGIEKYLGSGLIKGIGPIFAKRLVEVFGIDTLRIIEE
EPSRLLTVDGIGEVRLQRIRTAWEEQKEIREVMVFLQGHGVSSAYAAKIFKAYGKSSIAV
VQENPYRLAKDIYGIGFKTADRIAQAIGIEPHSPLRVEAGVIHVLNELAGEGHVYYPLDG
LTKASAGILEVDEELVTQAVERLRREERVVCLPVLRTQTDEPEPQGVAAYLASLYAAEEG
VARRLQVLTEGGELPADIDIERAILWAEQVNRLHLAEQQREAIRAALIRKLLVITGGPGT
GKTTILRCILQILEKKHRRMLLCSPTGRAAKRMSEATGREAKTIHRLLEFSPKDGRFKRD
QHRPLDADLVIVDEASMIDIVLMNSLLKAIPPAAGLILVGDVDQLPSVGPGAVLRDIIAS
GLVQVIRLSEIFRQARESQIVVNAHRINRGEMPFCTDWEAQEHGDCYLLAKQDALEVQAA
ILELAARGLPSRHRVDTLEELQILSPMQKGPIGAMQLNQALQALLNPSGPELLRAGRLYR
RGDRVMQIRNNYDKDVYNGDIGRIVTLNLEDREVTVRFDDRHVTYDFNELDELVLAYAVT
IHKSQGSEYPVVVIPMHTAHYVMLQRNLLYTAITRGRRLVVLVGTKKAIAIAVKNQKIQL
RYTGLVARLQKGLSACNAETESRELSLQLAE
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgcgatcatacgacacgctccagggaacgctggagcgaatcacgtacgtcaac
gaagagaaccactatgtggtggccaggctccaggtatccggacgccgggacctggccacc
attgtaggcaacctgccgaccgtcacgccgggcgagactctcaagctgaccggcgagtgg
atccagcacaaccgatacggcgaacagttcaaggtcgaagccttcgaaaccatctccccc
gccacgctcaccggtatcgagaagtatctgggctccggcctcatcaaggggatcggcccg
atctttgccaaaaggctggtggaggtcttcggtatcgacaccctgcgtattatcgaggag
gagccctcccgcctgctcacggtggatgggatcggcgaggttcgacttcagcggatccgg
accgcctgggaggagcagaaagagatccgggaggtgatggtctttctgcagggccatggc
gtctcctccgcctatgccgccaagatcttcaaagcctacggaaaatcctccatcgctgtt
gtccaggaaaacccctaccggctggccaaggacatctatgggatcggcttcaagaccgcc
gaccggatcgcccaggcgatcgggattgagccgcattcgccgctgcgggtggaggccggg
gtcatccatgtcctgaacgagctggccggggagggccacgtctactacccccttgacggc
ctcacgaaagcgagcgccggtattctggaggtcgacgaggagctggtgacccaggccgtt
gaacggcttcgacgcgaggaacgggtggtctgcctgcctgtgcttcgtacacagacggat
gagcctgaaccgcaaggggtggcggcctacctcgcctcgctgtatgcggcggaggaaggg
gtcgcccggcgcctgcaggtcctgactgaagggggcgagctccccgcagacatcgacatc
gaacgcgccattctctgggcggagcaggtgaacaggctacacttggcggaacaacagagg
gaggcgatccgtgcggccctcatacgcaagctgttggtcatcaccggcggccctggtacc
ggcaagacgaccatcctgcggtgcatcctgcagatcctggagaaaaaacaccgccggatg
ctcctctgctctcctacggggcgggcagcaaagcgaatgagcgaggccacgggtcgggaa
gccaagaccatccaccgcctcctggagttcagtcctaaggatggtcggttcaagcgagac
cagcacagaccgttggatgccgatctggtgatcgtggacgaggcctcgatgatcgacatc
gtgctgatgaactcccttctgaaggccatcccgccggctgccggtctgattctggtgggt
gatgtggaccagctcccatcggtagggccgggcgcggtgctgcgcgacatcattgcgtcg
ggccttgtgcaggtcatccgactatccgagatcttccggcaggccagggagagccagatt
gtggtcaatgcccaccggatcaatcggggggagatgccgttctgcacggattgggaggcg
caggagcacggcgactgttacctgctcgccaaacaagacgcgctggaggtccaggcggcg
atcctggagctggcggcgcgggggctgccttcacggcatcgcgtcgatacgctggaggag
ttacagatcctgagcccgatgcagaaagggccgatcggcgccatgcaactgaatcaggcg
ctgcaggcgctcctaaacccgtcagggccggagctgcttcgcgccggtcgcctctaccgg
cgtggggatcgcgtgatgcagatcaggaataactacgacaaggacgtctataacggcgac
atcggccggatcgtcacgctcaacctggaagaccgcgaggtcactgtccggtttgacgat
cgccacgtcacctacgacttcaacgagctggatgaactggtgctcgcctacgctgttacc
atccacaagagccagggcagtgagtatccggtcgtcgtcatcccgatgcacacggcgcac
tacgtcatgcttcagcgaaacctcctgtacaccgccattacgcgaggcagacgcctggtc
gtcctggtaggcaccaaaaaggcgatcgccatcgccgtgaagaatcagaagatccagctt
cgctacaccggcctcgtagctcgactgcaaaagggcctgtctgcgtgcaacgcagagacg
gaaagccgggaactgtcactccagcttgccgaatga

DBGET integrated database retrieval system